BLASTX nr result
ID: Rehmannia27_contig00040906
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00040906 (366 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081125.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Se... 77 2e-14 ref|XP_012845716.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Er... 77 4e-14 gb|KDP25603.1| hypothetical protein JCGZ_20759 [Jatropha curcas] 76 8e-14 ref|XP_012087106.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Ja... 76 8e-14 ref|XP_015083585.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [So... 75 2e-13 ref|XP_006363737.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [So... 75 2e-13 gb|KVH95474.1| hypothetical protein Ccrd_002436 [Cynara carduncu... 74 4e-13 gb|EYU31982.1| hypothetical protein MIMGU_mgv1a012102mg [Erythra... 72 7e-13 ref|XP_012843933.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Er... 72 1e-12 ref|XP_010539945.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Ta... 72 2e-12 emb|CDP09891.1| unnamed protein product [Coffea canephora] 72 2e-12 emb|CAN83831.1| hypothetical protein VITISV_003974 [Vitis vinifera] 69 2e-12 gb|ACU24168.1| unknown [Glycine max] 66 3e-12 ref|XP_009789635.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Ni... 71 3e-12 ref|XP_009593138.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Ni... 71 3e-12 emb|CDO97699.1| unnamed protein product [Coffea canephora] 71 5e-12 ref|XP_004245716.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [So... 71 5e-12 ref|XP_013725818.1| PREDICTED: UDP-glucuronate 4-epimerase 4-lik... 67 7e-12 ref|XP_015088896.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 70 9e-12 ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 70 9e-12 >ref|XP_011081125.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Sesamum indicum] Length = 439 Score = 77.4 bits (189), Expect = 2e-14 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSS 252 ISLARKELGYKPTTDLE GLKKFVKWYLSYYGAKKKS+ Sbjct: 401 ISLARKELGYKPTTDLEMGLKKFVKWYLSYYGAKKKSA 438 >ref|XP_012845716.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Erythranthe guttata] gi|604319110|gb|EYU30447.1| hypothetical protein MIMGU_mgv1a006641mg [Erythranthe guttata] Length = 437 Score = 76.6 bits (187), Expect = 4e-14 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSS 252 I+LARKELGYKPTTDLETGLKKFVKWY+SYYG+KKKS+ Sbjct: 399 ITLARKELGYKPTTDLETGLKKFVKWYISYYGSKKKSA 436 >gb|KDP25603.1| hypothetical protein JCGZ_20759 [Jatropha curcas] Length = 436 Score = 75.9 bits (185), Expect = 8e-14 Identities = 35/41 (85%), Positives = 40/41 (97%), Gaps = 1/41 (2%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYY-GAKKKSSSW 246 ISLA+K+LGYKPTTDLETGLKKFV+WYLSYY G+KKK+SSW Sbjct: 396 ISLAQKDLGYKPTTDLETGLKKFVRWYLSYYSGSKKKTSSW 436 >ref|XP_012087106.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Jatropha curcas] Length = 448 Score = 75.9 bits (185), Expect = 8e-14 Identities = 35/41 (85%), Positives = 40/41 (97%), Gaps = 1/41 (2%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYY-GAKKKSSSW 246 ISLA+K+LGYKPTTDLETGLKKFV+WYLSYY G+KKK+SSW Sbjct: 396 ISLAQKDLGYKPTTDLETGLKKFVRWYLSYYSGSKKKTSSW 436 >ref|XP_015083585.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Solanum pennellii] Length = 446 Score = 75.1 bits (183), Expect = 2e-13 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSSSW 246 I+LA ELGYKPTTDLE GLKKFVKWY+SYYG+KKK SSW Sbjct: 407 ITLAHTELGYKPTTDLEMGLKKFVKWYVSYYGSKKKKSSW 446 >ref|XP_006363737.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Solanum tuberosum] Length = 446 Score = 75.1 bits (183), Expect = 2e-13 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSSSW 246 I+LA ELGYKPTTDLE GLKKFVKWY+SYYG+KKK SSW Sbjct: 407 ITLAHTELGYKPTTDLEMGLKKFVKWYVSYYGSKKKKSSW 446 >gb|KVH95474.1| hypothetical protein Ccrd_002436 [Cynara cardunculus var. scolymus] Length = 440 Score = 73.9 bits (180), Expect = 4e-13 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSS 252 ISLA KELGY+PTTDLETGLKKFVKWYL YYGAKKK++ Sbjct: 402 ISLAHKELGYRPTTDLETGLKKFVKWYLDYYGAKKKNA 439 >gb|EYU31982.1| hypothetical protein MIMGU_mgv1a012102mg [Erythranthe guttata] Length = 261 Score = 72.0 bits (175), Expect = 7e-13 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSS 252 ISLA++ELGYKPTTDL+TGLKKFV+WYLSYYG +KKSS Sbjct: 223 ISLAQRELGYKPTTDLQTGLKKFVRWYLSYYGNEKKSS 260 >ref|XP_012843933.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Erythranthe guttata] Length = 317 Score = 72.0 bits (175), Expect = 1e-12 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSS 252 ISLA++ELGYKPTTDL+TGLKKFV+WYLSYYG +KKSS Sbjct: 279 ISLAQRELGYKPTTDLQTGLKKFVRWYLSYYGNEKKSS 316 >ref|XP_010539945.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Tarenaya hassleriana] Length = 437 Score = 72.0 bits (175), Expect = 2e-12 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSSSW 246 ISLA+ ELGYKPTTDLETGLKKFVKWYL++Y KK SSW Sbjct: 398 ISLAQAELGYKPTTDLETGLKKFVKWYLNFYTGSKKKSSW 437 >emb|CDP09891.1| unnamed protein product [Coffea canephora] Length = 454 Score = 72.0 bits (175), Expect = 2e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSS 252 ISLA KELGYKPTTDLE GLKKFVKWY+ YYG+KKKS+ Sbjct: 416 ISLAHKELGYKPTTDLEAGLKKFVKWYVGYYGSKKKSA 453 >emb|CAN83831.1| hypothetical protein VITISV_003974 [Vitis vinifera] Length = 150 Score = 68.6 bits (166), Expect = 2e-12 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSS 252 ISLA++ELGYKPTTDL+TGLKKFVKWYL+YY A KK++ Sbjct: 112 ISLAQRELGYKPTTDLQTGLKKFVKWYLNYYSAGKKTA 149 >gb|ACU24168.1| unknown [Glycine max] Length = 53 Score = 65.9 bits (159), Expect = 3e-12 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYG 270 IS AR+ELGYKPTTDL+TGLKKFVKWYLSYYG Sbjct: 14 ISSARRELGYKPTTDLQTGLKKFVKWYLSYYG 45 >ref|XP_009789635.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana sylvestris] Length = 445 Score = 71.2 bits (173), Expect = 3e-12 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSS 252 I+LA+KELGYKPTTDLE GLKKFVKWY++YYG+KKKS+ Sbjct: 407 ITLAQKELGYKPTTDLEIGLKKFVKWYVNYYGSKKKSA 444 >ref|XP_009593138.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana tomentosiformis] Length = 445 Score = 71.2 bits (173), Expect = 3e-12 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSS 252 I+LA+KELGYKPTTDLE GLKKFVKWY++YYG+KKKS+ Sbjct: 407 ITLAQKELGYKPTTDLEIGLKKFVKWYVNYYGSKKKSA 444 >emb|CDO97699.1| unnamed protein product [Coffea canephora] Length = 437 Score = 70.9 bits (172), Expect = 5e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSS 252 ISLA++ELGYKPTTDL+TGLKKFV+WYLSYYG KKSS Sbjct: 399 ISLAQRELGYKPTTDLQTGLKKFVRWYLSYYGNGKKSS 436 >ref|XP_004245716.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Solanum lycopersicum] Length = 445 Score = 70.9 bits (172), Expect = 5e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSS 252 I+LA ELGYKPTTDLE GLKKFVKWY+SYYG+KKKSS Sbjct: 407 ITLAHTELGYKPTTDLEMGLKKFVKWYVSYYGSKKKSS 444 >ref|XP_013725818.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Brassica napus] Length = 151 Score = 67.4 bits (163), Expect = 7e-12 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSSS 249 ISLA++ELGYKPTTDL+TGLKKFV+WYLSYY KK+++ Sbjct: 112 ISLAQRELGYKPTTDLQTGLKKFVRWYLSYYSGGKKAAA 150 >ref|XP_015088896.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum pennellii] Length = 435 Score = 70.1 bits (170), Expect = 9e-12 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSS 252 ISLA++ELGYKPTTDL+TGLKKFV+WYLSYYG KKS+ Sbjct: 397 ISLAQRELGYKPTTDLQTGLKKFVRWYLSYYGEGKKSA 434 >ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum] Length = 435 Score = 70.1 bits (170), Expect = 9e-12 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -2 Query: 365 ISLARKELGYKPTTDLETGLKKFVKWYLSYYGAKKKSS 252 ISLA++ELGYKPTTDL+TGLKKFV+WYLSYYG KKS+ Sbjct: 397 ISLAQRELGYKPTTDLQTGLKKFVRWYLSYYGEGKKSA 434