BLASTX nr result
ID: Rehmannia27_contig00039444
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00039444 (625 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002312817.2| hypothetical protein POPTR_0009s16560g [Popu... 61 2e-08 ref|XP_006384815.1| hypothetical protein POPTR_0004s21320g [Popu... 58 3e-07 ref|XP_002275909.1| PREDICTED: uncharacterized protein LOC100246... 57 4e-07 ref|XP_002312818.1| hypothetical protein POPTR_0009s16550g [Popu... 57 5e-07 ref|XP_011000930.1| PREDICTED: uncharacterized protein LOC105108... 57 5e-07 gb|EEF38528.1| conserved hypothetical protein [Ricinus communis] 57 5e-07 ref|XP_002523802.2| PREDICTED: uncharacterized protein LOC827191... 57 7e-07 ref|XP_006379365.1| hypothetical protein POPTR_0009s16550g [Popu... 57 7e-07 ref|XP_012077854.1| PREDICTED: uncharacterized protein LOC105638... 56 8e-07 ref|XP_009347784.1| PREDICTED: uncharacterized protein LOC103939... 55 1e-06 ref|XP_008351289.1| PREDICTED: uncharacterized protein LOC103414... 55 1e-06 ref|XP_007015821.1| Uncharacterized protein TCM_041417 [Theobrom... 55 3e-06 ref|XP_011459330.1| PREDICTED: uncharacterized protein LOC105349... 54 4e-06 ref|XP_006384813.1| hypothetical protein POPTR_0004s21310g [Popu... 54 4e-06 ref|XP_011007089.1| PREDICTED: uncharacterized protein LOC105112... 54 4e-06 ref|XP_011007079.1| PREDICTED: uncharacterized protein LOC105112... 54 5e-06 emb|CAN67239.1| hypothetical protein VITISV_004804 [Vitis vinifera] 57 5e-06 ref|XP_010089822.1| hypothetical protein L484_022338 [Morus nota... 54 5e-06 ref|XP_006384814.1| hypothetical protein POPTR_0004s21310g [Popu... 54 8e-06 >ref|XP_002312817.2| hypothetical protein POPTR_0009s16560g [Populus trichocarpa] gi|550331870|gb|EEE86772.2| hypothetical protein POPTR_0009s16560g [Populus trichocarpa] Length = 159 Score = 61.2 bits (147), Expect = 2e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAPNG 234 ++IPETWGQEDLL DWIDYS+FDKLLAP+G Sbjct: 106 VMIPETWGQEDLLTDWIDYSSFDKLLAPDG 135 >ref|XP_006384815.1| hypothetical protein POPTR_0004s21320g [Populus trichocarpa] gi|550341583|gb|ERP62612.1| hypothetical protein POPTR_0004s21320g [Populus trichocarpa] Length = 159 Score = 57.8 bits (138), Expect = 3e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAPNG 234 ++IP+TWGQE+LL DWIDYS+FDKLLAP G Sbjct: 102 VMIPDTWGQENLLTDWIDYSSFDKLLAPKG 131 >ref|XP_002275909.1| PREDICTED: uncharacterized protein LOC100246831 [Vitis vinifera] Length = 127 Score = 56.6 bits (135), Expect = 4e-07 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAPNG 234 ++IP+ WG+EDLLK+WIDYS+FD LLAPNG Sbjct: 72 VLIPDKWGKEDLLKEWIDYSSFDALLAPNG 101 >ref|XP_002312818.1| hypothetical protein POPTR_0009s16550g [Populus trichocarpa] gi|118486650|gb|ABK95162.1| unknown [Populus trichocarpa] gi|222849226|gb|EEE86773.1| hypothetical protein POPTR_0009s16550g [Populus trichocarpa] Length = 139 Score = 56.6 bits (135), Expect = 5e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAPNG 234 ++IP+TWGQED LKDWID S FD+LLAPNG Sbjct: 84 VMIPDTWGQEDSLKDWIDCSAFDELLAPNG 113 >ref|XP_011000930.1| PREDICTED: uncharacterized protein LOC105108346 [Populus euphratica] Length = 140 Score = 56.6 bits (135), Expect = 5e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAPNG 234 ++IP+TWGQED LKDWID S FD+LLAPNG Sbjct: 85 VMIPDTWGQEDSLKDWIDCSAFDELLAPNG 114 >gb|EEF38528.1| conserved hypothetical protein [Ricinus communis] Length = 140 Score = 56.6 bits (135), Expect = 5e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAPNG 234 ++IP+TWGQEDLLKDWID S+FDK LAP+G Sbjct: 81 VLIPDTWGQEDLLKDWIDCSSFDKSLAPDG 110 >ref|XP_002523802.2| PREDICTED: uncharacterized protein LOC8271914 [Ricinus communis] Length = 155 Score = 56.6 bits (135), Expect = 7e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAPNG 234 ++IP+TWGQEDLLKDWID S+FDK LAP+G Sbjct: 88 VLIPDTWGQEDLLKDWIDCSSFDKSLAPDG 117 >ref|XP_006379365.1| hypothetical protein POPTR_0009s16550g [Populus trichocarpa] gi|550331869|gb|ERP57162.1| hypothetical protein POPTR_0009s16550g [Populus trichocarpa] Length = 156 Score = 56.6 bits (135), Expect = 7e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAPNG 234 ++IP+TWGQED LKDWID S FD+LLAPNG Sbjct: 84 VMIPDTWGQEDSLKDWIDCSAFDELLAPNG 113 >ref|XP_012077854.1| PREDICTED: uncharacterized protein LOC105638638 [Jatropha curcas] gi|643723632|gb|KDP33126.1| hypothetical protein JCGZ_13573 [Jatropha curcas] Length = 141 Score = 56.2 bits (134), Expect = 8e-07 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAPNG 234 + IPETW QE+ LKDW+DYS+FD LLAPNG Sbjct: 95 VSIPETWSQENFLKDWVDYSSFDNLLAPNG 124 >ref|XP_009347784.1| PREDICTED: uncharacterized protein LOC103939425 [Pyrus x bretschneideri] Length = 137 Score = 55.5 bits (132), Expect = 1e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAPNG 234 +VIP++WGQE+LLKDWIDYS FD LL P G Sbjct: 80 VVIPDSWGQEELLKDWIDYSPFDALLVPKG 109 >ref|XP_008351289.1| PREDICTED: uncharacterized protein LOC103414699 [Malus domestica] Length = 137 Score = 55.5 bits (132), Expect = 1e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAPNG 234 +VIP++WGQE+LLKDWIDYS FD LL P G Sbjct: 80 VVIPDSWGQEELLKDWIDYSPFDALLVPKG 109 >ref|XP_007015821.1| Uncharacterized protein TCM_041417 [Theobroma cacao] gi|508786184|gb|EOY33440.1| Uncharacterized protein TCM_041417 [Theobroma cacao] Length = 155 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAPNG 234 ++IP+ WG+E+LLKDWIDY +FD LLAPNG Sbjct: 100 VLIPDKWGKEELLKDWIDYPSFDSLLAPNG 129 >ref|XP_011459330.1| PREDICTED: uncharacterized protein LOC105349931 [Fragaria vesca subsp. vesca] Length = 128 Score = 53.9 bits (128), Expect = 4e-06 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAPNG 234 + IP++WGQE+LLKDWIDYS FD LL P G Sbjct: 68 VTIPDSWGQEELLKDWIDYSPFDALLVPTG 97 >ref|XP_006384813.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa] gi|550341581|gb|ERP62610.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa] Length = 147 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAP 240 ++IP+TWGQE+LLKDWID STFD+LLAP Sbjct: 94 VMIPDTWGQENLLKDWIDCSTFDELLAP 121 >ref|XP_011007089.1| PREDICTED: uncharacterized protein LOC105112884 isoform X2 [Populus euphratica] Length = 148 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAP 240 ++IP+TWGQE+LLKDWID STFD+LLAP Sbjct: 95 VMIPDTWGQENLLKDWIDCSTFDELLAP 122 >ref|XP_011007079.1| PREDICTED: uncharacterized protein LOC105112884 isoform X1 [Populus euphratica] Length = 150 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAP 240 ++IP+TWGQE+LLKDWID STFD+LLAP Sbjct: 95 VMIPDTWGQENLLKDWIDCSTFDELLAP 122 >emb|CAN67239.1| hypothetical protein VITISV_004804 [Vitis vinifera] Length = 920 Score = 56.6 bits (135), Expect = 5e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAPNG 234 ++IP+ WG+EDLLK+WIDYS+FD LLAPNG Sbjct: 733 VLIPDKWGKEDLLKEWIDYSSFDALLAPNG 762 >ref|XP_010089822.1| hypothetical protein L484_022338 [Morus notabilis] gi|587848150|gb|EXB38438.1| hypothetical protein L484_022338 [Morus notabilis] Length = 155 Score = 54.3 bits (129), Expect = 5e-06 Identities = 19/30 (63%), Positives = 28/30 (93%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAPNG 234 +V+P+ WG+E+L+KDWIDYS+FDK+L P+G Sbjct: 91 VVVPDRWGKEELMKDWIDYSSFDKVLVPSG 120 >ref|XP_006384814.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa] gi|550341582|gb|ERP62611.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa] Length = 190 Score = 54.3 bits (129), Expect = 8e-06 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = -3 Query: 323 IVIPETWGQEDLLKDWIDYSTFDKLLAP 240 ++IP+TWGQE+LLKDWID STFD+LLAP Sbjct: 135 VMIPDTWGQENLLKDWIDCSTFDELLAP 162