BLASTX nr result
ID: Rehmannia27_contig00038479
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00038479 (569 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF44034.1| conserved hypothetical protein [Ricinus communis] 59 4e-07 >gb|EEF44034.1| conserved hypothetical protein [Ricinus communis] Length = 431 Score = 58.9 bits (141), Expect = 4e-07 Identities = 33/61 (54%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = +1 Query: 382 IPEQGRPLYFN-LYHNGPQRMGLTRPSTTYDGNPILPGLAKLFISFKLSCELACLYLSLS 558 IPEQGRPLYFN LYHN P +GLTR + P P ++ LS +LA LYLSLS Sbjct: 273 IPEQGRPLYFNNLYHNRPPHIGLTRLAQLRPRIPYSPAWQSSLLASTLSYKLASLYLSLS 332 Query: 559 G 561 G Sbjct: 333 G 333