BLASTX nr result
ID: Rehmannia27_contig00038470
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00038470 (536 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009049767.1| hypothetical protein (mitochondrion) [Capsic... 96 8e-23 ref|YP_173390.1| hypothetical protein NitaMp044 [Nicotiana tabac... 77 2e-14 >ref|YP_009049767.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751868|gb|AIG89955.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667752039|gb|AIG90125.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 108 Score = 96.3 bits (238), Expect = 8e-23 Identities = 48/89 (53%), Positives = 65/89 (73%) Frame = +1 Query: 226 ENLRLYVGDDRSGASSSKQPSFDLNVSAVEQAVYEQTLEEIKSQKQTLADLLDPLIKKEA 405 + + L VG D SG S SK+PSFDLN+ +VE VYE EEIK +K LADLL+PLI++EA Sbjct: 2 DRIPLSVGGDGSGPSLSKKPSFDLNIPSVEHQVYELMEEEIKRRKAKLADLLEPLIQREA 61 Query: 406 RKYPDIQNLPSPTNVVEELIRRIGSNKAR 492 +YP+I+ LPSP +VE LI +GS++ + Sbjct: 62 ERYPNIRELPSPKAMVERLIESLGSDQIK 90 >ref|YP_173390.1| hypothetical protein NitaMp044 [Nicotiana tabacum] gi|56806553|dbj|BAD83454.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 222 Score = 77.4 bits (189), Expect = 2e-14 Identities = 60/179 (33%), Positives = 91/179 (50%), Gaps = 18/179 (10%) Frame = +1 Query: 52 ALSFWLLPLCGLNFDMLVRNLFRKGLRFLISRLGWGWKGPLSFF--LLTHCVEWVFSFME 225 AL F LL L+ +L+ L ++ W + +FF L+ +++ S M+ Sbjct: 17 ALFFSLLKRIFLSLTVLL-------LTPILLNCNWDFSFEAAFFTSFLSDFLDFWLSLMD 69 Query: 226 ENLRLYVGDDRSGASSSKQPSFDLNVSA----------VEQAVYEQTLEEIKSQKQTLAD 375 + L VG D SG S SK+PSFDLN+SA +E+A+ + L +IK QK LA+ Sbjct: 70 R-IPLSVGGDGSGPSLSKKPSFDLNISAAEEEPGDRSEIERALDQLELAKIKEQKDLLAE 128 Query: 376 LLDPLIKKEARK------YPDIQNLPSPTNVVEELIRRIGSNKARAENDHNTPLNNFRN 534 + PLI+ E + + ++ LPSP+ +VE +I R GS A N N P N R+ Sbjct: 129 QISPLIESEKARLVRRKWHRNLDELPSPSEMVEIIIDRFGSKAAYNANKPNVPRANLRH 187