BLASTX nr result
ID: Rehmannia27_contig00038319
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00038319 (621 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20726.1| hypothetical protein MIMGU_mgv1a016779mg [Erythra... 60 1e-08 >gb|EYU20726.1| hypothetical protein MIMGU_mgv1a016779mg [Erythranthe guttata] Length = 107 Score = 60.1 bits (144), Expect = 1e-08 Identities = 32/64 (50%), Positives = 38/64 (59%) Frame = +2 Query: 281 QFNASTEQNRRREATSQRQQPRPATRKHLRRPATAQEPAPKLWWXXXXXXXXXXTSPLLR 460 QFNAST + RR AT +R++ R ATR H RRP AQEP KLWW + + R Sbjct: 45 QFNASTTRKRRGGATLRRRRRRQATRTHHRRPVKAQEPEQKLWWRTRRAQPRRRLA-VRR 103 Query: 461 PSRC 472 PSRC Sbjct: 104 PSRC 107