BLASTX nr result
ID: Rehmannia27_contig00038275
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00038275 (912 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63415.1| hypothetical protein M569_11370, partial [Genlise... 57 9e-06 >gb|EPS63415.1| hypothetical protein M569_11370, partial [Genlisea aurea] Length = 285 Score = 56.6 bits (135), Expect = 9e-06 Identities = 36/61 (59%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = -1 Query: 180 REYACLLITLPEKSETLELGILLISADYLLYML-SLQVVLISATLPNEILEITSKFMTDP 4 R A L+ L E E L G D Y+ LQVVLISATLPNEILEITSKFMTDP Sbjct: 172 RTRAIKLLILDESDEMLSRGFKDQIYDVYRYLPPELQVVLISATLPNEILEITSKFMTDP 231 Query: 3 V 1 V Sbjct: 232 V 232