BLASTX nr result
ID: Rehmannia27_contig00038137
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00038137 (867 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14029.1| unnamed protein product [Coffea canephora] 60 3e-07 ref|XP_012855493.1| PREDICTED: putative ABC1 protein At2g40090 [... 58 6e-06 gb|EYU22351.1| hypothetical protein MIMGU_mgv1a003625mg [Erythra... 58 6e-06 gb|KVI09969.1| Leucine-rich repeat-containing protein [Cynara ca... 58 8e-06 gb|KHN36381.1| Putative ABC1 protein [Glycine soja] 57 8e-06 >emb|CDP14029.1| unnamed protein product [Coffea canephora] Length = 236 Score = 60.5 bits (145), Expect = 3e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 IVNTLHRLFPSFDYRWLVDEVRDSLPKVCC 92 IVNTLH+LFPSFDYRWLVDE+R+SLPK C Sbjct: 207 IVNTLHQLFPSFDYRWLVDEIRESLPKASC 236 >ref|XP_012855493.1| PREDICTED: putative ABC1 protein At2g40090 [Erythranthe guttata] Length = 539 Score = 57.8 bits (138), Expect = 6e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +3 Query: 3 IVNTLHRLFPSFDYRWLVDEVRDSLPK 83 IVNTLHRLFPSFDYRWL+DEV++SLPK Sbjct: 208 IVNTLHRLFPSFDYRWLIDEVKESLPK 234 >gb|EYU22351.1| hypothetical protein MIMGU_mgv1a003625mg [Erythranthe guttata] Length = 573 Score = 57.8 bits (138), Expect = 6e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +3 Query: 3 IVNTLHRLFPSFDYRWLVDEVRDSLPK 83 IVNTLHRLFPSFDYRWL+DEV++SLPK Sbjct: 242 IVNTLHRLFPSFDYRWLIDEVKESLPK 268 >gb|KVI09969.1| Leucine-rich repeat-containing protein [Cynara cardunculus var. scolymus] Length = 2157 Score = 57.8 bits (138), Expect = 8e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 3 IVNTLHRLFPSFDYRWLVDEVRDSLPK 83 IVNTLHRLFPSFDYRWLVDEVRD LP+ Sbjct: 238 IVNTLHRLFPSFDYRWLVDEVRDCLPR 264 >gb|KHN36381.1| Putative ABC1 protein [Glycine soja] Length = 555 Score = 57.4 bits (137), Expect = 8e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +3 Query: 3 IVNTLHRLFPSFDYRWLVDEVRDSLPKVCC 92 +VNTLHR FPSFDYRWL+DE+ +SLPK C Sbjct: 205 VVNTLHRFFPSFDYRWLIDEISESLPKASC 234