BLASTX nr result
ID: Rehmannia27_contig00038093
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00038093 (954 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078809.1| PREDICTED: dirigent protein 21-like [Sesamum... 60 5e-07 >ref|XP_011078809.1| PREDICTED: dirigent protein 21-like [Sesamum indicum] Length = 239 Score = 60.1 bits (144), Expect = 5e-07 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = +2 Query: 851 DDVLIYR-LCTSKFHSTDCDILLCCFKCISLWHFT 952 D V+ Y LCT K HST CDI+LCCFKCISLWHFT Sbjct: 189 DAVVEYNVLCTPKLHSTHCDIILCCFKCISLWHFT 223