BLASTX nr result
ID: Rehmannia27_contig00038051
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00038051 (483 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096067.1| PREDICTED: calcium-dependent protein kinase-... 96 2e-20 ref|XP_011086186.1| PREDICTED: calcium-dependent protein kinase-... 93 4e-19 gb|KHN11921.1| Calcium-dependent protein kinase 9 [Glycine soja] 91 1e-18 ref|XP_014622595.1| PREDICTED: calcium-dependent protein kinase ... 91 2e-18 ref|XP_009627158.1| PREDICTED: calcium-dependent protein kinase ... 91 2e-18 gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum] 91 2e-18 ref|XP_009770081.1| PREDICTED: calcium-dependent protein kinase ... 91 2e-18 gb|KHN38276.1| Calcium-dependent protein kinase 33 [Glycine soja] 90 3e-18 gb|KYP73408.1| Calcium-dependent protein kinase 9 [Cajanus cajan] 90 4e-18 ref|XP_004294385.1| PREDICTED: calcium-dependent protein kinase ... 90 4e-18 ref|XP_002518484.1| PREDICTED: calcium-dependent protein kinase ... 89 6e-18 ref|XP_010276092.1| PREDICTED: calcium-dependent protein kinase ... 89 1e-17 gb|KDO62722.1| hypothetical protein CISIN_1g0096581mg, partial [... 87 1e-17 gb|KVH89627.1| Calcium-binding EF-hand [Cynara cardunculus var. ... 88 2e-17 ref|XP_003519577.1| PREDICTED: calcium-dependent protein kinase ... 88 2e-17 ref|XP_009776253.1| PREDICTED: calcium-dependent protein kinase-... 88 2e-17 ref|XP_010092160.1| Calcium-dependent protein kinase 9 [Morus no... 87 3e-17 ref|XP_003617547.2| calcium-dependent kinase [Medicago truncatul... 87 4e-17 ref|XP_006452371.1| hypothetical protein CICLE_v10007983mg [Citr... 87 5e-17 emb|CDP04396.1| unnamed protein product [Coffea canephora] 87 5e-17 >ref|XP_011096067.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum] Length = 541 Score = 96.3 bits (238), Expect = 2e-20 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL Sbjct: 495 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 540 >ref|XP_011086186.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum] Length = 543 Score = 92.8 bits (229), Expect = 4e-19 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MKEYGMGDEATIKEIISEVDTDNDGRINY+EFCAMMRSGTQQ VKL Sbjct: 497 MKEYGMGDEATIKEIISEVDTDNDGRINYDEFCAMMRSGTQQPVKL 542 >gb|KHN11921.1| Calcium-dependent protein kinase 9 [Glycine soja] Length = 404 Score = 90.9 bits (224), Expect = 1e-18 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MKEYGMGDEATI+EIISEVDTDNDGRINYEEFC MMRSGTQQQ KL Sbjct: 358 MKEYGMGDEATIREIISEVDTDNDGRINYEEFCTMMRSGTQQQGKL 403 >ref|XP_014622595.1| PREDICTED: calcium-dependent protein kinase 33-like [Glycine max] gi|947065255|gb|KRH14398.1| hypothetical protein GLYMA_14G023500 [Glycine max] Length = 539 Score = 90.9 bits (224), Expect = 2e-18 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MKEYGMGDEATI+EIISEVDTDNDGRINYEEFC MMRSGTQQQ KL Sbjct: 493 MKEYGMGDEATIREIISEVDTDNDGRINYEEFCTMMRSGTQQQGKL 538 >ref|XP_009627158.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana tomentosiformis] Length = 534 Score = 90.5 bits (223), Expect = 2e-18 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MKEYGMGDEATIKEII+EVDTDNDGRINYEEFCAMMRSGTQ Q KL Sbjct: 488 MKEYGMGDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGTQPQPKL 533 >gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum] Length = 540 Score = 90.5 bits (223), Expect = 2e-18 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MKEYGMGDEATIKEII+EVDTDNDGRINYEEFCAMMRSGTQ Q KL Sbjct: 494 MKEYGMGDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGTQPQPKL 539 >ref|XP_009770081.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana sylvestris] Length = 542 Score = 90.5 bits (223), Expect = 2e-18 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MKEYGMGDEATIKEII+EVDTDNDGRINYEEFCAMMRSGTQ Q KL Sbjct: 496 MKEYGMGDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGTQPQPKL 541 >gb|KHN38276.1| Calcium-dependent protein kinase 33 [Glycine soja] Length = 391 Score = 89.7 bits (221), Expect = 3e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MKEYGMGDEATI+EIISEVDTDNDGRINY+EFC MMRSGTQQQ KL Sbjct: 345 MKEYGMGDEATIREIISEVDTDNDGRINYDEFCTMMRSGTQQQGKL 390 >gb|KYP73408.1| Calcium-dependent protein kinase 9 [Cajanus cajan] Length = 529 Score = 89.7 bits (221), Expect = 4e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MK+YGMGDEATI+EIISEVDTDNDGRINYEEFC MMRSGTQQQ KL Sbjct: 483 MKDYGMGDEATIREIISEVDTDNDGRINYEEFCTMMRSGTQQQGKL 528 >ref|XP_004294385.1| PREDICTED: calcium-dependent protein kinase 2-like [Fragaria vesca subsp. vesca] Length = 541 Score = 89.7 bits (221), Expect = 4e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MKEYGMGDEATI++IISEVDTDNDGRINYEEFC MMRSGTQQQ KL Sbjct: 495 MKEYGMGDEATIRDIISEVDTDNDGRINYEEFCTMMRSGTQQQGKL 540 >ref|XP_002518484.1| PREDICTED: calcium-dependent protein kinase 21 [Ricinus communis] gi|1000967617|ref|XP_015574254.1| PREDICTED: calcium-dependent protein kinase 21 [Ricinus communis] gi|1000967619|ref|XP_015574255.1| PREDICTED: calcium-dependent protein kinase 21 [Ricinus communis] gi|1000967621|ref|XP_015574256.1| PREDICTED: calcium-dependent protein kinase 21 [Ricinus communis] gi|223542329|gb|EEF43871.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 551 Score = 89.4 bits (220), Expect = 6e-18 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSG QQ KL Sbjct: 505 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGIQQAEKL 550 >ref|XP_010276092.1| PREDICTED: calcium-dependent protein kinase 2-like [Nelumbo nucifera] Length = 538 Score = 88.6 bits (218), Expect = 1e-17 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MKEYGMGDEA+IKEIISEVDTDNDGRINYEEFC MMRSG QQ VKL Sbjct: 492 MKEYGMGDEASIKEIISEVDTDNDGRINYEEFCTMMRSGMQQPVKL 537 >gb|KDO62722.1| hypothetical protein CISIN_1g0096581mg, partial [Citrus sinensis] gi|641843825|gb|KDO62723.1| hypothetical protein CISIN_1g0096581mg, partial [Citrus sinensis] Length = 293 Score = 86.7 bits (213), Expect = 1e-17 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MK+YGMGD+ TIKEIISEVDTDNDGRINY+EFCAMMRSGTQ Q KL Sbjct: 247 MKDYGMGDDDTIKEIISEVDTDNDGRINYDEFCAMMRSGTQPQAKL 292 >gb|KVH89627.1| Calcium-binding EF-hand [Cynara cardunculus var. scolymus] Length = 484 Score = 87.8 bits (216), Expect = 2e-17 Identities = 41/46 (89%), Positives = 42/46 (91%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MKEYGMGDEATIK+IISEVDTDNDGRINYEEFC MMRSGT Q KL Sbjct: 438 MKEYGMGDEATIKDIISEVDTDNDGRINYEEFCTMMRSGTAHQAKL 483 >ref|XP_003519577.1| PREDICTED: calcium-dependent protein kinase 33-like [Glycine max] gi|947125543|gb|KRH73749.1| hypothetical protein GLYMA_02G291300 [Glycine max] Length = 528 Score = 87.8 bits (216), Expect = 2e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MKEYGMG+EATI+EIISEVDTDNDGRINY+EFC MMRSGTQQQ KL Sbjct: 482 MKEYGMGNEATIREIISEVDTDNDGRINYDEFCTMMRSGTQQQGKL 527 >ref|XP_009776253.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Nicotiana sylvestris] Length = 551 Score = 87.8 bits (216), Expect = 2e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MKEYGMGDEATIKEII+EVDTD+DGRINYEEFCAMMRSGTQ Q K+ Sbjct: 505 MKEYGMGDEATIKEIIAEVDTDHDGRINYEEFCAMMRSGTQPQEKI 550 >ref|XP_010092160.1| Calcium-dependent protein kinase 9 [Morus notabilis] gi|587860405|gb|EXB50311.1| Calcium-dependent protein kinase 9 [Morus notabilis] Length = 548 Score = 87.4 bits (215), Expect = 3e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MK+YGMGDEATI+EIISEVDTDNDGRINY EFCAMMRSGTQ Q KL Sbjct: 502 MKDYGMGDEATIREIISEVDTDNDGRINYSEFCAMMRSGTQHQGKL 547 >ref|XP_003617547.2| calcium-dependent kinase [Medicago truncatula] gi|657385916|gb|AET00506.2| calcium-dependent kinase [Medicago truncatula] Length = 540 Score = 87.0 bits (214), Expect = 4e-17 Identities = 41/46 (89%), Positives = 42/46 (91%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MKEYGMGDE TI+EIISEVDTDNDGRINYEEFC MMRSG QQQ KL Sbjct: 494 MKEYGMGDEETIREIISEVDTDNDGRINYEEFCTMMRSGVQQQGKL 539 >ref|XP_006452371.1| hypothetical protein CICLE_v10007983mg [Citrus clementina] gi|985443619|ref|XP_015384652.1| PREDICTED: calcium-dependent protein kinase 2-like [Citrus sinensis] gi|557555597|gb|ESR65611.1| hypothetical protein CICLE_v10007983mg [Citrus clementina] Length = 529 Score = 86.7 bits (213), Expect = 5e-17 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 MK+YGMGD+ TIKEIISEVDTDNDGRINY+EFCAMMRSGTQ Q KL Sbjct: 483 MKDYGMGDDDTIKEIISEVDTDNDGRINYDEFCAMMRSGTQPQAKL 528 >emb|CDP04396.1| unnamed protein product [Coffea canephora] Length = 549 Score = 86.7 bits (213), Expect = 5e-17 Identities = 42/46 (91%), Positives = 42/46 (91%) Frame = -2 Query: 482 MKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKL 345 M EYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGT Q KL Sbjct: 503 MMEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTAAQGKL 548