BLASTX nr result
ID: Rehmannia27_contig00038024
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00038024 (568 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012843328.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [E... 70 5e-11 ref|XP_011076955.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [S... 65 3e-09 >ref|XP_012843328.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Erythranthe guttata] gi|604322009|gb|EYU32443.1| hypothetical protein MIMGU_mgv1a019706mg [Erythranthe guttata] Length = 563 Score = 70.5 bits (171), Expect = 5e-11 Identities = 35/52 (67%), Positives = 41/52 (78%) Frame = -2 Query: 156 TQEEIKSLPNPLSFDKKSGFDSQTKIYHSLLHLTQNQKIPSQPNLDIATYVL 1 T EE S+PN SFD K+GF+ QT IYHSL+ L ++QKIPS PNLDIATYVL Sbjct: 5 TSEEESSIPN--SFDNKNGFNPQTGIYHSLVQLNEHQKIPSHPNLDIATYVL 54 >ref|XP_011076955.1| PREDICTED: 4-coumarate--CoA ligase-like 5 [Sesamum indicum] Length = 568 Score = 65.5 bits (158), Expect = 3e-09 Identities = 30/55 (54%), Positives = 42/55 (76%) Frame = -2 Query: 165 MAITQEEIKSLPNPLSFDKKSGFDSQTKIYHSLLHLTQNQKIPSQPNLDIATYVL 1 MA+ E + + L FDK+SGFD+Q+ IY+SL+HL++ KIP+QPNLD AT+VL Sbjct: 1 MAMAGSEEEPVSQSLLFDKRSGFDAQSGIYYSLVHLSEQNKIPTQPNLDTATFVL 55