BLASTX nr result
ID: Rehmannia27_contig00037986
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00037986 (450 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837091.1| PREDICTED: uncharacterized protein LOC105957... 59 1e-07 ref|XP_011088464.1| PREDICTED: uncharacterized protein LOC105169... 55 3e-06 ref|XP_011088463.1| PREDICTED: uncharacterized protein LOC105169... 55 3e-06 >ref|XP_012837091.1| PREDICTED: uncharacterized protein LOC105957685 isoform X2 [Erythranthe guttata] gi|604333489|gb|EYU37840.1| hypothetical protein MIMGU_mgv1a010142mg [Erythranthe guttata] Length = 321 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/42 (66%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = -3 Query: 142 TGIYFLQLTSSVYPVSLCRRWNNGKLGGRK-SFLNFVGWKQR 20 TGI F TSS++P+ L RRWNNGK+GG K + LNFVGWKQR Sbjct: 3 TGICFFHSTSSLHPLFLYRRWNNGKIGGTKFTSLNFVGWKQR 44 >ref|XP_011088464.1| PREDICTED: uncharacterized protein LOC105169684 isoform X2 [Sesamum indicum] Length = 262 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/42 (66%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = -3 Query: 142 TGIYFLQLTSSVYPVSLCRRWNNGKLGGRK-SFLNFVGWKQR 20 TGI F S VYP R WNNGKLGGRK + LNFVGWKQR Sbjct: 3 TGICFFHSASHVYPRFPYRTWNNGKLGGRKFASLNFVGWKQR 44 >ref|XP_011088463.1| PREDICTED: uncharacterized protein LOC105169684 isoform X1 [Sesamum indicum] Length = 322 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/42 (66%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = -3 Query: 142 TGIYFLQLTSSVYPVSLCRRWNNGKLGGRK-SFLNFVGWKQR 20 TGI F S VYP R WNNGKLGGRK + LNFVGWKQR Sbjct: 3 TGICFFHSASHVYPRFPYRTWNNGKLGGRKFASLNFVGWKQR 44