BLASTX nr result
ID: Rehmannia27_contig00037746
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00037746 (567 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011102127.1| PREDICTED: uncharacterized protein LOC105180... 59 4e-07 ref|XP_012843273.1| PREDICTED: uncharacterized protein LOC105963... 58 1e-06 >ref|XP_011102127.1| PREDICTED: uncharacterized protein LOC105180157 [Sesamum indicum] Length = 658 Score = 59.3 bits (142), Expect = 4e-07 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -1 Query: 144 ILGGFFYWLQNVSQEGAFKPWKYGQCLAVEPGSPKNSQPP 25 IL GFF+WLQ++++EGAFKPWK G+CLAVEP + + P Sbjct: 617 ILRGFFFWLQHLTREGAFKPWKDGECLAVEPEDLRETSSP 656 >ref|XP_012843273.1| PREDICTED: uncharacterized protein LOC105963417 [Erythranthe guttata] gi|848886061|ref|XP_012843275.1| PREDICTED: uncharacterized protein LOC105963417 [Erythranthe guttata] Length = 633 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 144 ILGGFFYWLQNVSQEGAFKPWKYGQCLAVEPGSPKNS 34 IL GFF+WLQN++QEGAF+PWK +CLAVEP S +S Sbjct: 578 ILRGFFFWLQNLTQEGAFQPWKDRECLAVEPRSLASS 614