BLASTX nr result
ID: Rehmannia27_contig00037653
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00037653 (377 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19325.1| hypothetical protein MIMGU_mgv1a003209mg [Erythra... 58 2e-07 ref|XP_012827335.1| PREDICTED: myosin-1-like [Erythranthe guttata] 58 2e-07 >gb|EYU19325.1| hypothetical protein MIMGU_mgv1a003209mg [Erythranthe guttata] Length = 600 Score = 57.8 bits (138), Expect = 2e-07 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 2/57 (3%) Frame = +3 Query: 213 MAKKKVSNSQAHQEKQPLSKKQEESVKA--HQEVTAPSMDSEALEKFESLKSLNQML 377 MAKKKVS Q+HQEK PL +KQ++SVKA +QEV+ P MDSEA EK ESLKSLNQ+L Sbjct: 1 MAKKKVS--QSHQEK-PL-QKQDDSVKAAANQEVSPP-MDSEASEKLESLKSLNQIL 52 >ref|XP_012827335.1| PREDICTED: myosin-1-like [Erythranthe guttata] Length = 637 Score = 57.8 bits (138), Expect = 2e-07 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 2/57 (3%) Frame = +3 Query: 213 MAKKKVSNSQAHQEKQPLSKKQEESVKA--HQEVTAPSMDSEALEKFESLKSLNQML 377 MAKKKVS Q+HQEK PL +KQ++SVKA +QEV+ P MDSEA EK ESLKSLNQ+L Sbjct: 1 MAKKKVS--QSHQEK-PL-QKQDDSVKAAANQEVSPP-MDSEASEKLESLKSLNQIL 52