BLASTX nr result
ID: Rehmannia27_contig00037584
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00037584 (1176 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008386770.1| PREDICTED: WD repeat-containing protein 89 h... 58 4e-06 ref|XP_011079679.1| PREDICTED: WD repeat-containing protein 89 h... 58 8e-06 >ref|XP_008386770.1| PREDICTED: WD repeat-containing protein 89 homolog, partial [Malus domestica] Length = 275 Score = 58.2 bits (139), Expect = 4e-06 Identities = 25/38 (65%), Positives = 27/38 (71%) Frame = -2 Query: 620 FAVHCLSNVYMQILFWDWRTMKQTACLEESHTEDVTQV 507 F C Y QILFWDWR+ KQ ACLE+SH EDVTQV Sbjct: 23 FPPSCCLTCYAQILFWDWRSNKQVACLEDSHVEDVTQV 60 >ref|XP_011079679.1| PREDICTED: WD repeat-containing protein 89 homolog [Sesamum indicum] Length = 386 Score = 58.2 bits (139), Expect = 8e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -2 Query: 587 QILFWDWRTMKQTACLEESHTEDVTQV 507 QILFWDWRTMKQ ACLEESH EDVTQV Sbjct: 146 QILFWDWRTMKQVACLEESHMEDVTQV 172