BLASTX nr result
ID: Rehmannia27_contig00037533
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00037533 (394 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012851770.1| PREDICTED: uncharacterized protein LOC105971... 69 2e-11 prf||1718313A tnp1 protein 68 8e-11 emb|CAA40554.1| TNP1 [Antirrhinum majus] 68 8e-11 ref|XP_012853945.1| PREDICTED: uncharacterized protein LOC105973... 64 9e-10 >ref|XP_012851770.1| PREDICTED: uncharacterized protein LOC105971463 [Erythranthe guttata] Length = 512 Score = 69.3 bits (168), Expect = 2e-11 Identities = 30/59 (50%), Positives = 44/59 (74%) Frame = +3 Query: 117 SEKNRKTRTQLELLHRMGKKSYALVREAWKKKYGIYPTKADLFKECYYRADDPHISAVI 293 S+KN+ +R +L+L H MGKKS+A+V+E K+K G YPT+A+LF+ECYY+ D S + Sbjct: 202 SKKNKNSRGELKLFHCMGKKSFAVVKEKLKEKLGRYPTRAELFEECYYKEDSSSTSEAV 260 >prf||1718313A tnp1 protein Length = 484 Score = 67.8 bits (164), Expect = 8e-11 Identities = 31/60 (51%), Positives = 44/60 (73%) Frame = +3 Query: 114 ISEKNRKTRTQLELLHRMGKKSYALVREAWKKKYGIYPTKADLFKECYYRADDPHISAVI 293 ISE+ +++R +L +HRMGK+S A+ +E KK+ G +PT+A+LFKECYYR D SA I Sbjct: 208 ISEQKKESRAKLLFIHRMGKRSTAVQKEIVKKRLGRHPTRAELFKECYYRTDGSSASAAI 267 >emb|CAA40554.1| TNP1 [Antirrhinum majus] Length = 484 Score = 67.8 bits (164), Expect = 8e-11 Identities = 31/60 (51%), Positives = 44/60 (73%) Frame = +3 Query: 114 ISEKNRKTRTQLELLHRMGKKSYALVREAWKKKYGIYPTKADLFKECYYRADDPHISAVI 293 ISE+ +++R +L +HRMGK+S A+ +E KK+ G +PT+A+LFKECYYR D SA I Sbjct: 208 ISEQKKESRAKLLFIHRMGKRSTAVQKEIVKKRLGRHPTRAELFKECYYRTDGSSASAAI 267 >ref|XP_012853945.1| PREDICTED: uncharacterized protein LOC105973467 [Erythranthe guttata] gi|848910772|ref|XP_012853946.1| PREDICTED: uncharacterized protein LOC105973467 [Erythranthe guttata] gi|848910775|ref|XP_012853947.1| PREDICTED: uncharacterized protein LOC105973467 [Erythranthe guttata] gi|848910778|ref|XP_012853948.1| PREDICTED: uncharacterized protein LOC105973467 [Erythranthe guttata] Length = 224 Score = 63.5 bits (153), Expect = 9e-10 Identities = 26/58 (44%), Positives = 43/58 (74%) Frame = +3 Query: 120 EKNRKTRTQLELLHRMGKKSYALVREAWKKKYGIYPTKADLFKECYYRADDPHISAVI 293 +KN+ +R QL + H MGKKS+A+V+E ++++G YPT+A+LF+ECYY+ + S + Sbjct: 30 DKNKDSRDQLIMHHCMGKKSFAVVKEKLRERFGRYPTRAELFEECYYKPESSSTSRAV 87