BLASTX nr result
ID: Rehmannia27_contig00037522
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00037522 (2225 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010102098.1| hypothetical protein L484_004637 [Morus nota... 69 5e-11 ref|XP_010095454.1| hypothetical protein L484_005878 [Morus nota... 55 4e-06 >ref|XP_010102098.1| hypothetical protein L484_004637 [Morus notabilis] gi|587904108|gb|EXB92317.1| hypothetical protein L484_004637 [Morus notabilis] Length = 91 Score = 69.3 bits (168), Expect = 5e-11 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -1 Query: 1817 MPKSGRYRGSRDCTRPSSLNHSTEAIAKKAVRVEQVGHFSS 1695 MPKSGRYRGSRDCTRPSSL HSTEAIAKKA RVE+ SS Sbjct: 1 MPKSGRYRGSRDCTRPSSLLHSTEAIAKKAARVERTSSSSS 41 >ref|XP_010095454.1| hypothetical protein L484_005878 [Morus notabilis] gi|587871008|gb|EXB60280.1| hypothetical protein L484_005878 [Morus notabilis] Length = 66 Score = 54.7 bits (130), Expect = 4e-06 Identities = 30/50 (60%), Positives = 33/50 (66%) Frame = +1 Query: 1708 PTCSTLTAFFAIASVEWLRDEGRVQSLDPLYLPDLGI*LRE*LIPFDPAR 1857 P+C+ AFFAIA VE RDEGRVQSLDPLYLPD G+ P P R Sbjct: 10 PSCAA-PAFFAIAFVECKRDEGRVQSLDPLYLPDFGMNYENNSSPLIPLR 58