BLASTX nr result
ID: Rehmannia27_contig00037330
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00037330 (770 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100389.1| PREDICTED: cysteine-rich and transmembrane d... 60 9e-09 >ref|XP_011100389.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Sesamum indicum] Length = 77 Score = 60.5 bits (145), Expect = 9e-09 Identities = 29/62 (46%), Positives = 31/62 (50%) Frame = +3 Query: 309 MSNYNQTQVAYPPPGTAYPAEPQXXXXXXXXXXXXXXKXXXXXXXXXXXXSTKSRGDGFW 488 MSNY Q Q AYPPP T YPAEPQ K +T+SRGDGFW Sbjct: 1 MSNYTQNQAAYPPPATGYPAEPQGGYMAPPPPAGYPVKDGQQGLDQAPAATTQSRGDGFW 60 Query: 489 KG 494 KG Sbjct: 61 KG 62