BLASTX nr result
ID: Rehmannia27_contig00037128
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00037128 (404 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011102133.1| PREDICTED: uncharacterized protein LOC105180... 70 2e-11 >ref|XP_011102133.1| PREDICTED: uncharacterized protein LOC105180166 [Sesamum indicum] Length = 1724 Score = 70.1 bits (170), Expect = 2e-11 Identities = 36/86 (41%), Positives = 54/86 (62%) Frame = -1 Query: 266 ERRLDSVMNVRGSELYNKRDYDGTRRDSGMNDRVHELYNKMDYEERRWDIGINDGGCELY 87 +RR D N LY +R+Y+ R DS +NDR EL+ + DY++RRWD +D + Y Sbjct: 8 DRRWDIGSNDWARSLYKERNYEERRWDSSINDRSRELFLETDYDQRRWDNRTDDPVQKFY 67 Query: 86 HEGGDDNKRCDYSSNDAVLLQLENRQ 9 EGG++ +R +Y +N+ V L+LE RQ Sbjct: 68 FEGGEE-RRWNYGNNEEVWLRLEKRQ 92