BLASTX nr result
ID: Rehmannia27_contig00036790
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00036790 (354 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] 56 6e-07 >emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] Length = 1382 Score = 56.2 bits (134), Expect = 6e-07 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = -3 Query: 136 WLLDSGASHHMSPNAEXXXXXXXXXXXXVMTADGTPMHLAGVGSV 2 W+LDSGASHHMSP++ VMTADGTPM LAGVGSV Sbjct: 342 WVLDSGASHHMSPDSSSFTSVSPLSSIPVMTADGTPMPLAGVGSV 386