BLASTX nr result
ID: Rehmannia27_contig00036480
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00036480 (365 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092222.1| PREDICTED: pentatricopeptide repeat-containi... 102 3e-24 ref|XP_012839820.1| PREDICTED: pentatricopeptide repeat-containi... 97 6e-22 gb|EYU35391.1| hypothetical protein MIMGU_mgv1a024783mg, partial... 72 9e-13 >ref|XP_011092222.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Sesamum indicum] Length = 306 Score = 102 bits (255), Expect = 3e-24 Identities = 59/117 (50%), Positives = 71/117 (60%) Frame = -3 Query: 351 MALKTILTQSLFHPKSKLPSLPLFSRHFFHSPTVLPPCSSPFSAAKISKTPNPIFFLTRT 172 MALKT +T+ F KSK PS PLFSR FF S + PP FSAAK+SK P L+RT Sbjct: 1 MALKTTVTRCFFLSKSKPPSFPLFSRLFFLSSSPSPP----FSAAKVSKCLYPFAPLSRT 56 Query: 171 YCAXXXXXXXXXXXXKLVNFSLPXXXXXXXXXXTPKSATREIDKSKLPPPYNPFSKK 1 +C+ KLVNFSLP ++AT+E+DKSKLPPPYNPF+KK Sbjct: 57 FCSPSEAPPPKKRNPKLVNFSLPSDSESDSESTAERTATKEVDKSKLPPPYNPFNKK 113 >ref|XP_012839820.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Erythranthe guttata] Length = 312 Score = 97.1 bits (240), Expect = 6e-22 Identities = 60/120 (50%), Positives = 70/120 (58%), Gaps = 1/120 (0%) Frame = -3 Query: 357 MPMA-LKTILTQSLFHPKSKLPSLPLFSRHFFHSPTVLPPCSSPFSAAKISKTPNPIFFL 181 MPMA LKT + +SLF K + PSLPLF R FF+S T+ P SSPFSAA+ SK P F Sbjct: 1 MPMAALKTTVARSLFLSKCRPPSLPLFRRLFFNSSTLSSPRSSPFSAAEFSKPPFSFFHP 60 Query: 180 TRTYCAXXXXXXXXXXXXKLVNFSLPXXXXXXXXXXTPKSATREIDKSKLPPPYNPFSKK 1 TRT+C KLVNFSLP T +A ++ K KLPPPYNPF KK Sbjct: 61 TRTFCT-SESPPPKKRNPKLVNFSLPSDSDSDSETTTAAAAAKQAVKPKLPPPYNPFDKK 119 >gb|EYU35391.1| hypothetical protein MIMGU_mgv1a024783mg, partial [Erythranthe guttata] Length = 324 Score = 72.4 bits (176), Expect = 9e-13 Identities = 44/93 (47%), Positives = 51/93 (54%) Frame = -3 Query: 279 SRHFFHSPTVLPPCSSPFSAAKISKTPNPIFFLTRTYCAXXXXXXXXXXXXKLVNFSLPX 100 SR FF+S T+ P SSPFSAA+ SK P F TRT+C KLVNFSLP Sbjct: 40 SRLFFNSSTLSSPRSSPFSAAEFSKPPFSFFHPTRTFCT-SESPPPKKRNPKLVNFSLPS 98 Query: 99 XXXXXXXXXTPKSATREIDKSKLPPPYNPFSKK 1 T +A ++ K KLPPPYNPF KK Sbjct: 99 DSDSDSETTTAAAAAKQAVKPKLPPPYNPFDKK 131