BLASTX nr result
ID: Rehmannia27_contig00036333
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00036333 (701 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004222277.1| hypothetical protein BevumaM_p039 (mitochond... 62 5e-09 >ref|YP_004222277.1| hypothetical protein BevumaM_p039 (mitochondrion) [Beta vulgaris subsp. maritima] gi|346683152|ref|YP_004842084.1| hypothetical protein BemaM_p037 (mitochondrion) [Beta macrocarpa] gi|317905712|emb|CBX33240.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] gi|319439792|emb|CBX33292.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] gi|320148721|emb|CBJ23359.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] gi|345500070|emb|CBX24886.1| hypothetical protein (mitochondrion) [Beta macrocarpa] gi|384939198|emb|CBL52045.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 102 Score = 61.6 bits (148), Expect = 5e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 701 QFLRKLFLTSQVVQQLYLTARRGGSPFEFSR 609 QFLRKLFLTSQVVQQLYL ARRGGSPFEFSR Sbjct: 72 QFLRKLFLTSQVVQQLYLIARRGGSPFEFSR 102