BLASTX nr result
ID: Rehmannia27_contig00036253
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00036253 (858 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080006.1| PREDICTED: pentatricopeptide repeat-containi... 117 3e-26 ref|XP_012831521.1| PREDICTED: pentatricopeptide repeat-containi... 114 3e-25 ref|XP_009781797.1| PREDICTED: putative pentatricopeptide repeat... 95 2e-18 ref|XP_009612407.1| PREDICTED: putative pentatricopeptide repeat... 95 2e-18 ref|XP_009781795.1| PREDICTED: putative pentatricopeptide repeat... 95 2e-18 ref|XP_010038027.1| PREDICTED: putative pentatricopeptide repeat... 92 1e-17 ref|XP_010038026.1| PREDICTED: pentatricopeptide repeat-containi... 91 3e-17 gb|KCW49825.1| hypothetical protein EUGRSUZ_K03302 [Eucalyptus g... 91 4e-17 gb|KCW49827.1| hypothetical protein EUGRSUZ_K03305 [Eucalyptus g... 90 9e-17 ref|XP_010038028.1| PREDICTED: putative pentatricopeptide repeat... 90 9e-17 ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containi... 90 1e-16 ref|XP_010100079.1| hypothetical protein L484_005753 [Morus nota... 88 4e-16 emb|CDP03708.1| unnamed protein product [Coffea canephora] 87 7e-16 ref|XP_004292190.1| PREDICTED: putative pentatricopeptide repeat... 87 8e-16 ref|XP_010278114.1| PREDICTED: putative pentatricopeptide repeat... 87 1e-15 ref|XP_008372326.1| PREDICTED: putative pentatricopeptide repeat... 84 8e-15 ref|XP_009354905.1| PREDICTED: putative pentatricopeptide repeat... 82 5e-14 ref|XP_009354903.1| PREDICTED: putative pentatricopeptide repeat... 82 5e-14 ref|XP_015876666.1| PREDICTED: putative pentatricopeptide repeat... 82 7e-14 ref|XP_015876665.1| PREDICTED: pentatricopeptide repeat-containi... 82 7e-14 >ref|XP_011080006.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Sesamum indicum] gi|747066637|ref|XP_011080007.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Sesamum indicum] gi|747066639|ref|XP_011080008.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Sesamum indicum] gi|747066641|ref|XP_011080009.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Sesamum indicum] gi|747066643|ref|XP_011080010.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Sesamum indicum] Length = 622 Score = 117 bits (294), Expect = 3e-26 Identities = 56/67 (83%), Positives = 63/67 (94%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 PDV TFNTLMRGFC+NNDAPKVVELLQKMA R F PDSYTA+IVVDLLSKDKSYS++L+L Sbjct: 555 PDVVTFNTLMRGFCNNNDAPKVVELLQKMAKRKFSPDSYTASIVVDLLSKDKSYSKFLQL 614 Query: 182 IPKFSDK 202 IP+FS+K Sbjct: 615 IPRFSNK 621 >ref|XP_012831521.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Erythranthe guttata] gi|604348335|gb|EYU46490.1| hypothetical protein MIMGU_mgv11b018784mg [Erythranthe guttata] Length = 612 Score = 114 bits (286), Expect = 3e-25 Identities = 55/67 (82%), Positives = 61/67 (91%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 PDVATFNTLMRGFCDNNDA KVVELL MA+R+F+PDSYTA IVVDLLSKD+SY +YL+L Sbjct: 539 PDVATFNTLMRGFCDNNDADKVVELLHLMAERSFVPDSYTAAIVVDLLSKDQSYLKYLEL 598 Query: 182 IPKFSDK 202 IP FSDK Sbjct: 599 IPSFSDK 605 >ref|XP_009781797.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X2 [Nicotiana sylvestris] Length = 547 Score = 94.7 bits (234), Expect = 2e-18 Identities = 44/68 (64%), Positives = 54/68 (79%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 P+V TFNTLMRGFCDNNDAP+VV LLQKMA+++ PD T ++VV+LLSKD Y EYL L Sbjct: 467 PNVVTFNTLMRGFCDNNDAPQVVNLLQKMAEKHISPDLSTISLVVELLSKDDKYHEYLNL 526 Query: 182 IPKFSDKA 205 IP F ++ Sbjct: 527 IPTFPTRS 534 >ref|XP_009612407.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116958|ref|XP_009612408.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116960|ref|XP_009612409.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116962|ref|XP_009612410.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116964|ref|XP_009612411.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116966|ref|XP_009612412.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] gi|697116968|ref|XP_009612413.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nicotiana tomentosiformis] Length = 599 Score = 94.7 bits (234), Expect = 2e-18 Identities = 44/68 (64%), Positives = 54/68 (79%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 P+V TFNTLMRGFCDNNDAP+VV LLQKMA+++ PD T ++VV+LLSKD Y EYL L Sbjct: 529 PNVVTFNTLMRGFCDNNDAPQVVNLLQKMAEKHLSPDLSTISLVVELLSKDDKYHEYLNL 588 Query: 182 IPKFSDKA 205 IP F ++ Sbjct: 589 IPTFPTRS 596 >ref|XP_009781795.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Nicotiana sylvestris] gi|698461540|ref|XP_009781796.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Nicotiana sylvestris] Length = 605 Score = 94.7 bits (234), Expect = 2e-18 Identities = 44/68 (64%), Positives = 54/68 (79%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 P+V TFNTLMRGFCDNNDAP+VV LLQKMA+++ PD T ++VV+LLSKD Y EYL L Sbjct: 525 PNVVTFNTLMRGFCDNNDAPQVVNLLQKMAEKHISPDLSTISLVVELLSKDDKYHEYLNL 584 Query: 182 IPKFSDKA 205 IP F ++ Sbjct: 585 IPTFPTRS 592 >ref|XP_010038027.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Eucalyptus grandis] gi|629083381|gb|KCW49826.1| hypothetical protein EUGRSUZ_K03304 [Eucalyptus grandis] Length = 547 Score = 92.4 bits (228), Expect = 1e-17 Identities = 43/64 (67%), Positives = 52/64 (81%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 P+V TFNTLM FC NN+A KV+ELL+KMA +N +PDS TA+IV DLLSKDK+Y EYL L Sbjct: 482 PNVVTFNTLMHAFCQNNEALKVIELLKKMAGKNMIPDSTTASIVFDLLSKDKNYHEYLTL 541 Query: 182 IPKF 193 +P F Sbjct: 542 LPAF 545 >ref|XP_010038026.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Eucalyptus grandis] Length = 556 Score = 91.3 bits (225), Expect = 3e-17 Identities = 40/65 (61%), Positives = 54/65 (83%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 P+V TFNTLM GFC NN+ KV+ELL+KMA+R+ LPD +T ++VVD+LSKD+++ EYL L Sbjct: 491 PNVITFNTLMHGFCQNNEIVKVIELLKKMAERSILPDDFTTSMVVDVLSKDENHKEYLNL 550 Query: 182 IPKFS 196 +P FS Sbjct: 551 LPTFS 555 >gb|KCW49825.1| hypothetical protein EUGRSUZ_K03302 [Eucalyptus grandis] Length = 625 Score = 91.3 bits (225), Expect = 4e-17 Identities = 40/65 (61%), Positives = 54/65 (83%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 P+V TFNTLM GFC NN+ KV+ELL+KMA+R+ LPD +T ++VVD+LSKD+++ EYL L Sbjct: 560 PNVITFNTLMHGFCQNNEIVKVIELLKKMAERSILPDDFTTSMVVDVLSKDENHKEYLNL 619 Query: 182 IPKFS 196 +P FS Sbjct: 620 LPTFS 624 >gb|KCW49827.1| hypothetical protein EUGRSUZ_K03305 [Eucalyptus grandis] Length = 624 Score = 90.1 bits (222), Expect = 9e-17 Identities = 42/64 (65%), Positives = 52/64 (81%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 P+V TFNTLM FC N++A KV+ELL+KMA +N LPD+ TA+IV DLLSKDK+Y EYL L Sbjct: 559 PNVVTFNTLMHAFCQNHEALKVIELLKKMAGKNILPDATTASIVFDLLSKDKNYHEYLTL 618 Query: 182 IPKF 193 +P F Sbjct: 619 LPAF 622 >ref|XP_010038028.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Eucalyptus grandis] gi|702499674|ref|XP_010038029.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Eucalyptus grandis] Length = 644 Score = 90.1 bits (222), Expect = 9e-17 Identities = 42/64 (65%), Positives = 52/64 (81%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 P+V TFNTLM FC N++A KV+ELL+KMA +N LPD+ TA+IV DLLSKDK+Y EYL L Sbjct: 579 PNVVTFNTLMHAFCQNHEALKVIELLKKMAGKNILPDATTASIVFDLLSKDKNYHEYLTL 638 Query: 182 IPKF 193 +P F Sbjct: 639 LPAF 642 >ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] gi|297735515|emb|CBI17955.3| unnamed protein product [Vitis vinifera] Length = 627 Score = 89.7 bits (221), Expect = 1e-16 Identities = 41/64 (64%), Positives = 53/64 (82%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 P++ TFNTLMRGFC N++ KVVELLQ+MA+++F PD+ T +IVVDLLSKD+ Y EYL L Sbjct: 551 PNLVTFNTLMRGFCQNDEMQKVVELLQEMAEKDFSPDASTISIVVDLLSKDEKYREYLHL 610 Query: 182 IPKF 193 +P F Sbjct: 611 LPTF 614 >ref|XP_010100079.1| hypothetical protein L484_005753 [Morus notabilis] gi|587892744|gb|EXB81315.1| hypothetical protein L484_005753 [Morus notabilis] Length = 549 Score = 88.2 bits (217), Expect = 4e-16 Identities = 42/74 (56%), Positives = 54/74 (72%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 P+ T+NTLMR FCDNN+ PKVVELL +MA RN PD+ T +IV+DL+SKDK Y E L L Sbjct: 469 PNYVTYNTLMRSFCDNNELPKVVELLHQMAKRNVQPDASTFSIVIDLVSKDKKYRECLDL 528 Query: 182 IPKFSDKA*DVDDV 223 +P F + + DD+ Sbjct: 529 LPTFPMQEKEKDDM 542 >emb|CDP03708.1| unnamed protein product [Coffea canephora] Length = 607 Score = 87.4 bits (215), Expect = 7e-16 Identities = 39/68 (57%), Positives = 55/68 (80%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 P++ TFNTLMRGFC +N+A +V+ELLQ++A+R FLPD+ T ++V+DLLSKD + +YL L Sbjct: 540 PNLVTFNTLMRGFCISNEADRVIELLQRLAEREFLPDASTLSVVIDLLSKDDRHMKYLNL 599 Query: 182 IPKFSDKA 205 IP F +A Sbjct: 600 IPTFPIQA 607 >ref|XP_004292190.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Fragaria vesca subsp. vesca] Length = 634 Score = 87.4 bits (215), Expect = 8e-16 Identities = 41/65 (63%), Positives = 51/65 (78%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 P++ TFNTLMRGFC N+D KVVELL KM++RN PD T +IV+DLLSKD+SY + L Sbjct: 560 PNLVTFNTLMRGFCQNDDLEKVVELLHKMSERNLSPDISTTSIVIDLLSKDESYRKCLDW 619 Query: 182 IPKFS 196 +PKFS Sbjct: 620 LPKFS 624 >ref|XP_010278114.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nelumbo nucifera] gi|720071617|ref|XP_010278115.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Nelumbo nucifera] Length = 632 Score = 86.7 bits (213), Expect = 1e-15 Identities = 40/77 (51%), Positives = 56/77 (72%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 P+V TFNTLMRGFC N+D KV+ELL KM +R+ PD+ TAT+VV+LL+K++ Y +YL Sbjct: 545 PNVVTFNTLMRGFCHNSDVEKVIELLHKMVERDVSPDASTATLVVELLTKEEKYHKYLTS 604 Query: 182 IPKFSDKA*DVDDVLNM 232 +P F + DV+N+ Sbjct: 605 LPTFLPRDQQKGDVMNV 621 >ref|XP_008372326.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Malus domestica] gi|657961464|ref|XP_008372327.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Malus domestica] Length = 633 Score = 84.3 bits (207), Expect = 8e-15 Identities = 37/64 (57%), Positives = 50/64 (78%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 P++ T+N LMRGFC N+D+ KVVE+L KMA+RN PD+ T +IV+DLLSKD+ Y + L L Sbjct: 561 PNIITYNILMRGFCQNDDSAKVVEJLHKMAERNLSPDAITVSIVIDLLSKDEKYRKCLDL 620 Query: 182 IPKF 193 +P F Sbjct: 621 LPTF 624 >ref|XP_009354905.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X2 [Pyrus x bretschneideri] Length = 633 Score = 82.0 bits (201), Expect = 5e-14 Identities = 37/64 (57%), Positives = 49/64 (76%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 P++ T+N LMRGFC N+D+ KVVELL KMA+RN PD+ T +IV+DLL KD+ Y + L L Sbjct: 561 PNIITYNILMRGFCQNDDSAKVVELLHKMAERNLSPDASTVSIVIDLLLKDEKYRKCLDL 620 Query: 182 IPKF 193 +P F Sbjct: 621 LPTF 624 >ref|XP_009354903.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Pyrus x bretschneideri] gi|694328162|ref|XP_009354904.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Pyrus x bretschneideri] Length = 634 Score = 82.0 bits (201), Expect = 5e-14 Identities = 37/64 (57%), Positives = 49/64 (76%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 P++ T+N LMRGFC N+D+ KVVELL KMA+RN PD+ T +IV+DLL KD+ Y + L L Sbjct: 561 PNIITYNILMRGFCQNDDSAKVVELLHKMAERNLSPDASTVSIVIDLLLKDEKYRKCLDL 620 Query: 182 IPKF 193 +P F Sbjct: 621 LPTF 624 >ref|XP_015876666.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X2 [Ziziphus jujuba] Length = 600 Score = 81.6 bits (200), Expect = 7e-14 Identities = 37/64 (57%), Positives = 50/64 (78%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 PD+ T+NTLM GF +N+ + VVELL KMA++N LPD++T +IV+DLLS DK+Y E L L Sbjct: 531 PDIVTYNTLMHGFLENSKSSNVVELLCKMAEKNVLPDAFTFSIVIDLLSMDKNYRECLNL 590 Query: 182 IPKF 193 +P F Sbjct: 591 LPTF 594 >ref|XP_015876665.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Ziziphus jujuba] Length = 625 Score = 81.6 bits (200), Expect = 7e-14 Identities = 37/64 (57%), Positives = 50/64 (78%) Frame = +2 Query: 2 PDVATFNTLMRGFCDNNDAPKVVELLQKMADRNFLPDSYTATIVVDLLSKDKSYSEYLKL 181 PD+ T+NTLM GF +N+ + VVELL KMA++N LPD++T +IV+DLLS DK+Y E L L Sbjct: 556 PDIVTYNTLMHGFLENSKSSNVVELLCKMAEKNVLPDAFTFSIVIDLLSMDKNYRECLNL 615 Query: 182 IPKF 193 +P F Sbjct: 616 LPTF 619