BLASTX nr result
ID: Rehmannia27_contig00036079
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00036079 (365 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73969.1| hypothetical protein M569_00788 [Genlisea aurea] 52 2e-06 >gb|EPS73969.1| hypothetical protein M569_00788 [Genlisea aurea] Length = 101 Score = 52.0 bits (123), Expect = 2e-06 Identities = 29/57 (50%), Positives = 40/57 (70%), Gaps = 4/57 (7%) Frame = -2 Query: 259 SAGESLSSSLIDPE---NCSADEALPRRKPKFGSLVDIYRKTDQPLIKNRS-KKRPR 101 S ES SSS+I+PE N S D+ LPR +FGSL++IYR+T+ P + + S KK+PR Sbjct: 43 SDDESSSSSIINPEKERNSSNDDCLPRINQRFGSLIEIYRRTEPPPVGSPSPKKKPR 99