BLASTX nr result
ID: Rehmannia27_contig00035801
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00035801 (424 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_019646317.1| hypothetical protein [Novispirillum itersonii] 59 2e-08 ref|WP_057266682.1| hypothetical protein [Acidovorax sp. Root219... 58 3e-08 gb|KQB61327.1| hypothetical protein AE621_00420 [Acidovorax sp. ... 57 1e-07 >ref|WP_019646317.1| hypothetical protein [Novispirillum itersonii] Length = 133 Score = 58.9 bits (141), Expect = 2e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -2 Query: 102 VSTIPDQQAGTRRRRRIHSDEFKANAVASCMQPG 1 ++T PDQQAG R+RRR HSDEFKA+AVA+CMQPG Sbjct: 1 MNTTPDQQAGARQRRRKHSDEFKADAVAACMQPG 34 >ref|WP_057266682.1| hypothetical protein [Acidovorax sp. Root219] gi|946176929|gb|KRC28760.1| hypothetical protein ASE28_17470 [Acidovorax sp. Root219] Length = 133 Score = 58.2 bits (139), Expect = 3e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 102 VSTIPDQQAGTRRRRRIHSDEFKANAVASCMQPG 1 ++TI DQQ RRRRR+HSDEFKA+AVASCMQPG Sbjct: 1 MNTISDQQVSPRRRRRLHSDEFKADAVASCMQPG 34 >gb|KQB61327.1| hypothetical protein AE621_00420 [Acidovorax sp. SD340] Length = 130 Score = 56.6 bits (135), Expect = 1e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 102 VSTIPDQQAGTRRRRRIHSDEFKANAVASCMQPG 1 ++T P+Q RRRRR+HSDEFKANAVASCMQPG Sbjct: 1 MNTTPEQSGEGRRRRRLHSDEFKANAVASCMQPG 34