BLASTX nr result
ID: Rehmannia27_contig00035356
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00035356 (410 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098523.1| PREDICTED: U-box domain-containing protein 4... 57 8e-07 >ref|XP_011098523.1| PREDICTED: U-box domain-containing protein 40-like [Sesamum indicum] Length = 500 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +3 Query: 3 LEVLTEKHEEDEQINWEELLNLDDDFSRTQ 92 LEVL EKHEEDE INWEELLN DDD SRTQ Sbjct: 459 LEVLREKHEEDEDINWEELLNSDDDLSRTQ 488