BLASTX nr result
ID: Rehmannia27_contig00035154
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00035154 (462 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096067.1| PREDICTED: calcium-dependent protein kinase-... 88 2e-17 ref|XP_011086186.1| PREDICTED: calcium-dependent protein kinase-... 84 3e-16 gb|KHN11921.1| Calcium-dependent protein kinase 9 [Glycine soja] 82 1e-15 gb|KYP73408.1| Calcium-dependent protein kinase 9 [Cajanus cajan] 82 1e-15 ref|XP_014622595.1| PREDICTED: calcium-dependent protein kinase ... 82 1e-15 ref|XP_009627158.1| PREDICTED: calcium-dependent protein kinase ... 82 2e-15 gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum] 82 2e-15 ref|XP_009770081.1| PREDICTED: calcium-dependent protein kinase ... 82 2e-15 gb|KHN38276.1| Calcium-dependent protein kinase 33 [Glycine soja] 81 2e-15 ref|XP_004294385.1| PREDICTED: calcium-dependent protein kinase ... 81 3e-15 ref|XP_002518484.1| PREDICTED: calcium-dependent protein kinase ... 81 5e-15 gb|KDO62722.1| hypothetical protein CISIN_1g0096581mg, partial [... 79 6e-15 emb|CDP04396.1| unnamed protein product [Coffea canephora] 80 6e-15 ref|XP_010092160.1| Calcium-dependent protein kinase 9 [Morus no... 80 8e-15 gb|KOM33809.1| hypothetical protein LR48_Vigan01g336500 [Vigna a... 76 9e-15 gb|KVH89627.1| Calcium-binding EF-hand [Cynara cardunculus var. ... 79 1e-14 ref|XP_003519577.1| PREDICTED: calcium-dependent protein kinase ... 79 2e-14 ref|XP_006452371.1| hypothetical protein CICLE_v10007983mg [Citr... 79 2e-14 ref|XP_009776253.1| PREDICTED: calcium-dependent protein kinase-... 79 2e-14 ref|XP_008345823.1| PREDICTED: calcium-dependent protein kinase ... 74 2e-14 >ref|XP_011096067.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum] Length = 541 Score = 87.8 bits (216), Expect = 2e-17 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF Sbjct: 500 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 541 >ref|XP_011086186.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum] Length = 543 Score = 84.3 bits (207), Expect = 3e-16 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGDEATIKEIISEVDTDNDGRINY+EFCAMMRSGTQQ VKLF Sbjct: 502 MGDEATIKEIISEVDTDNDGRINYDEFCAMMRSGTQQPVKLF 543 >gb|KHN11921.1| Calcium-dependent protein kinase 9 [Glycine soja] Length = 404 Score = 82.4 bits (202), Expect = 1e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGDEATI+EIISEVDTDNDGRINYEEFC MMRSGTQQQ KLF Sbjct: 363 MGDEATIREIISEVDTDNDGRINYEEFCTMMRSGTQQQGKLF 404 >gb|KYP73408.1| Calcium-dependent protein kinase 9 [Cajanus cajan] Length = 529 Score = 82.4 bits (202), Expect = 1e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGDEATI+EIISEVDTDNDGRINYEEFC MMRSGTQQQ KLF Sbjct: 488 MGDEATIREIISEVDTDNDGRINYEEFCTMMRSGTQQQGKLF 529 >ref|XP_014622595.1| PREDICTED: calcium-dependent protein kinase 33-like [Glycine max] gi|947065255|gb|KRH14398.1| hypothetical protein GLYMA_14G023500 [Glycine max] Length = 539 Score = 82.4 bits (202), Expect = 1e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGDEATI+EIISEVDTDNDGRINYEEFC MMRSGTQQQ KLF Sbjct: 498 MGDEATIREIISEVDTDNDGRINYEEFCTMMRSGTQQQGKLF 539 >ref|XP_009627158.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana tomentosiformis] Length = 534 Score = 82.0 bits (201), Expect = 2e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGDEATIKEII+EVDTDNDGRINYEEFCAMMRSGTQ Q KLF Sbjct: 493 MGDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGTQPQPKLF 534 >gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum] Length = 540 Score = 82.0 bits (201), Expect = 2e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGDEATIKEII+EVDTDNDGRINYEEFCAMMRSGTQ Q KLF Sbjct: 499 MGDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGTQPQPKLF 540 >ref|XP_009770081.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana sylvestris] Length = 542 Score = 82.0 bits (201), Expect = 2e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGDEATIKEII+EVDTDNDGRINYEEFCAMMRSGTQ Q KLF Sbjct: 501 MGDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGTQPQPKLF 542 >gb|KHN38276.1| Calcium-dependent protein kinase 33 [Glycine soja] Length = 391 Score = 81.3 bits (199), Expect = 2e-15 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGDEATI+EIISEVDTDNDGRINY+EFC MMRSGTQQQ KLF Sbjct: 350 MGDEATIREIISEVDTDNDGRINYDEFCTMMRSGTQQQGKLF 391 >ref|XP_004294385.1| PREDICTED: calcium-dependent protein kinase 2-like [Fragaria vesca subsp. vesca] Length = 541 Score = 81.3 bits (199), Expect = 3e-15 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGDEATI++IISEVDTDNDGRINYEEFC MMRSGTQQQ KLF Sbjct: 500 MGDEATIRDIISEVDTDNDGRINYEEFCTMMRSGTQQQGKLF 541 >ref|XP_002518484.1| PREDICTED: calcium-dependent protein kinase 21 [Ricinus communis] gi|1000967617|ref|XP_015574254.1| PREDICTED: calcium-dependent protein kinase 21 [Ricinus communis] gi|1000967619|ref|XP_015574255.1| PREDICTED: calcium-dependent protein kinase 21 [Ricinus communis] gi|1000967621|ref|XP_015574256.1| PREDICTED: calcium-dependent protein kinase 21 [Ricinus communis] gi|223542329|gb|EEF43871.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 551 Score = 80.9 bits (198), Expect = 5e-15 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSG QQ KLF Sbjct: 510 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGIQQAEKLF 551 >gb|KDO62722.1| hypothetical protein CISIN_1g0096581mg, partial [Citrus sinensis] gi|641843825|gb|KDO62723.1| hypothetical protein CISIN_1g0096581mg, partial [Citrus sinensis] Length = 293 Score = 79.3 bits (194), Expect = 6e-15 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGD+ TIKEIISEVDTDNDGRINY+EFCAMMRSGTQ Q KLF Sbjct: 252 MGDDDTIKEIISEVDTDNDGRINYDEFCAMMRSGTQPQAKLF 293 >emb|CDP04396.1| unnamed protein product [Coffea canephora] Length = 549 Score = 80.5 bits (197), Expect = 6e-15 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGT Q KLF Sbjct: 508 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTAAQGKLF 549 >ref|XP_010092160.1| Calcium-dependent protein kinase 9 [Morus notabilis] gi|587860405|gb|EXB50311.1| Calcium-dependent protein kinase 9 [Morus notabilis] Length = 548 Score = 80.1 bits (196), Expect = 8e-15 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGDEATI+EIISEVDTDNDGRINY EFCAMMRSGTQ Q KLF Sbjct: 507 MGDEATIREIISEVDTDNDGRINYSEFCAMMRSGTQHQGKLF 548 >gb|KOM33809.1| hypothetical protein LR48_Vigan01g336500 [Vigna angularis] Length = 145 Score = 75.9 bits (185), Expect = 9e-15 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQ 348 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSG QQ Sbjct: 99 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGMPQQ 136 >gb|KVH89627.1| Calcium-binding EF-hand [Cynara cardunculus var. scolymus] Length = 484 Score = 79.3 bits (194), Expect = 1e-14 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGDEATIK+IISEVDTDNDGRINYEEFC MMRSGT Q KLF Sbjct: 443 MGDEATIKDIISEVDTDNDGRINYEEFCTMMRSGTAHQAKLF 484 >ref|XP_003519577.1| PREDICTED: calcium-dependent protein kinase 33-like [Glycine max] gi|947125543|gb|KRH73749.1| hypothetical protein GLYMA_02G291300 [Glycine max] Length = 528 Score = 79.3 bits (194), Expect = 2e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MG+EATI+EIISEVDTDNDGRINY+EFC MMRSGTQQQ KLF Sbjct: 487 MGNEATIREIISEVDTDNDGRINYDEFCTMMRSGTQQQGKLF 528 >ref|XP_006452371.1| hypothetical protein CICLE_v10007983mg [Citrus clementina] gi|985443619|ref|XP_015384652.1| PREDICTED: calcium-dependent protein kinase 2-like [Citrus sinensis] gi|557555597|gb|ESR65611.1| hypothetical protein CICLE_v10007983mg [Citrus clementina] Length = 529 Score = 79.3 bits (194), Expect = 2e-14 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGD+ TIKEIISEVDTDNDGRINY+EFCAMMRSGTQ Q KLF Sbjct: 488 MGDDDTIKEIISEVDTDNDGRINYDEFCAMMRSGTQPQAKLF 529 >ref|XP_009776253.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Nicotiana sylvestris] Length = 551 Score = 79.3 bits (194), Expect = 2e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGDEATIKEII+EVDTD+DGRINYEEFCAMMRSGTQ Q K+F Sbjct: 510 MGDEATIKEIIAEVDTDHDGRINYEEFCAMMRSGTQPQEKIF 551 >ref|XP_008345823.1| PREDICTED: calcium-dependent protein kinase 2-like [Malus domestica] Length = 103 Score = 73.6 bits (179), Expect = 2e-14 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -2 Query: 461 MGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 336 MGD+ TI+EIISEVD DNDGRINY EFCAMMRSG QQ KLF Sbjct: 62 MGDDNTIREIISEVDADNDGRINYSEFCAMMRSGAQQPAKLF 103