BLASTX nr result
ID: Rehmannia27_contig00035139
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00035139 (597 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012827762.1| PREDICTED: OTU domain-containing protein DDB... 105 4e-26 ref|XP_011089257.1| PREDICTED: OTU domain-containing protein DDB... 106 4e-24 ref|XP_012831609.1| PREDICTED: OTU domain-containing protein DDB... 105 1e-23 gb|EYU18803.1| hypothetical protein MIMGU_mgv1a024652mg, partial... 89 3e-19 gb|KDO60179.1| hypothetical protein CISIN_1g018742mg [Citrus sin... 74 2e-12 ref|XP_006488048.1| PREDICTED: OTU domain-containing protein DDB... 74 2e-12 emb|CDP07077.1| unnamed protein product [Coffea canephora] 74 4e-12 gb|KJB20329.1| hypothetical protein B456_003G143700 [Gossypium r... 72 6e-12 ref|XP_012471572.1| PREDICTED: OTU domain-containing protein DDB... 72 8e-12 gb|KJB20330.1| hypothetical protein B456_003G143700 [Gossypium r... 72 9e-12 ref|XP_012471569.1| PREDICTED: OTU domain-containing protein DDB... 72 1e-11 ref|XP_010935732.1| PREDICTED: OTU domain-containing protein DDB... 68 3e-10 ref|XP_010935728.1| PREDICTED: OTU domain-containing protein DDB... 68 4e-10 ref|XP_003573222.1| PREDICTED: OTU domain-containing protein DDB... 67 6e-10 ref|XP_012064764.1| PREDICTED: uncharacterized protein LOC105628... 67 8e-10 ref|XP_008800530.1| PREDICTED: OTU domain-containing protein DDB... 67 9e-10 ref|XP_008800529.1| PREDICTED: OTU domain-containing protein DDB... 67 1e-09 ref|XP_007143734.1| hypothetical protein PHAVU_007G097000g [Phas... 67 1e-09 gb|AFK48767.1| unknown [Lotus japonicus] 62 2e-09 ref|XP_004291568.1| PREDICTED: uncharacterized protein LOC101296... 66 2e-09 >ref|XP_012827762.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Erythranthe guttata] Length = 103 Score = 105 bits (261), Expect = 4e-26 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDDYN 142 VI LSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDDYN Sbjct: 57 VISLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDDYN 103 >ref|XP_011089257.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Sesamum indicum] gi|747083762|ref|XP_011089258.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Sesamum indicum] Length = 354 Score = 106 bits (264), Expect = 4e-24 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDDYN 142 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDDY+ Sbjct: 308 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDDYS 354 >ref|XP_012831609.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Erythranthe guttata] gi|604343183|gb|EYU42158.1| hypothetical protein MIMGU_mgv1a025952mg [Erythranthe guttata] Length = 355 Score = 105 bits (261), Expect = 1e-23 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDDYN 142 VI LSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDDYN Sbjct: 309 VISLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDDYN 355 >gb|EYU18803.1| hypothetical protein MIMGU_mgv1a024652mg, partial [Erythranthe guttata] Length = 160 Score = 89.4 bits (220), Expect = 3e-19 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHV 121 VI LSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHV Sbjct: 98 VISLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHV 137 >gb|KDO60179.1| hypothetical protein CISIN_1g018742mg [Citrus sinensis] Length = 351 Score = 74.3 bits (181), Expect = 2e-12 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDD 136 VI+LSFWAEVHYNSIYP GD PTF TKKKKRW+ +++ +E PD+ Sbjct: 305 VIYLSFWAEVHYNSIYPAGDVPTFETKKKKRWRLFRNKQMESPDE 349 >ref|XP_006488048.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Citrus sinensis] gi|568869687|ref|XP_006488049.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Citrus sinensis] gi|568869691|ref|XP_006488051.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Citrus sinensis] Length = 351 Score = 74.3 bits (181), Expect = 2e-12 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDD 136 VI+LSFWAEVHYNSIYP GD PTF TKKKKRW+ +++ +E PD+ Sbjct: 305 VIYLSFWAEVHYNSIYPAGDVPTFETKKKKRWRLFRNKQMESPDE 349 >emb|CDP07077.1| unnamed protein product [Coffea canephora] Length = 343 Score = 73.6 bits (179), Expect = 4e-12 Identities = 33/45 (73%), Positives = 36/45 (80%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDD 136 VIFLSFWAEVHYNSIYPEGD TF TK+KKR + EH E+PDD Sbjct: 297 VIFLSFWAEVHYNSIYPEGDLTTFGTKRKKRRSFPRQEHFEIPDD 341 >gb|KJB20329.1| hypothetical protein B456_003G143700 [Gossypium raimondii] Length = 293 Score = 72.4 bits (176), Expect = 6e-12 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDDY 139 VIFLSFWAEVHYNSIYP GD P+F KKKKRW+ +++H+E D Y Sbjct: 247 VIFLSFWAEVHYNSIYPVGDVPSFGMKKKKRWRMLRNKHLESTDGY 292 >ref|XP_012471572.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X2 [Gossypium raimondii] gi|763752938|gb|KJB20326.1| hypothetical protein B456_003G143700 [Gossypium raimondii] gi|763752939|gb|KJB20327.1| hypothetical protein B456_003G143700 [Gossypium raimondii] Length = 329 Score = 72.4 bits (176), Expect = 8e-12 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDDY 139 VIFLSFWAEVHYNSIYP GD P+F KKKKRW+ +++H+E D Y Sbjct: 283 VIFLSFWAEVHYNSIYPVGDVPSFGMKKKKRWRMLRNKHLESTDGY 328 >gb|KJB20330.1| hypothetical protein B456_003G143700 [Gossypium raimondii] Length = 339 Score = 72.4 bits (176), Expect = 9e-12 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDDY 139 VIFLSFWAEVHYNSIYP GD P+F KKKKRW+ +++H+E D Y Sbjct: 293 VIFLSFWAEVHYNSIYPVGDVPSFGMKKKKRWRMLRNKHLESTDGY 338 >ref|XP_012471569.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X1 [Gossypium raimondii] gi|823143526|ref|XP_012471570.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X1 [Gossypium raimondii] gi|823143528|ref|XP_012471571.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X1 [Gossypium raimondii] gi|763752937|gb|KJB20325.1| hypothetical protein B456_003G143700 [Gossypium raimondii] gi|763752940|gb|KJB20328.1| hypothetical protein B456_003G143700 [Gossypium raimondii] Length = 354 Score = 72.4 bits (176), Expect = 1e-11 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDDY 139 VIFLSFWAEVHYNSIYP GD P+F KKKKRW+ +++H+E D Y Sbjct: 308 VIFLSFWAEVHYNSIYPVGDVPSFGMKKKKRWRMLRNKHLESTDGY 353 >ref|XP_010935732.1| PREDICTED: OTU domain-containing protein DDB_G0284757 isoform X4 [Elaeis guineensis] Length = 312 Score = 67.8 bits (164), Expect = 3e-10 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEH 118 VIFLSFWAEVHYNSIYPEGD PT TKKKKRW ++H Sbjct: 274 VIFLSFWAEVHYNSIYPEGDLPTSETKKKKRWWHFGNKH 312 >ref|XP_010935728.1| PREDICTED: OTU domain-containing protein DDB_G0284757 isoform X1 [Elaeis guineensis] gi|743835138|ref|XP_010935729.1| PREDICTED: OTU domain-containing protein DDB_G0284757 isoform X1 [Elaeis guineensis] Length = 342 Score = 67.8 bits (164), Expect = 4e-10 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEH 118 VIFLSFWAEVHYNSIYPEGD PT TKKKKRW ++H Sbjct: 304 VIFLSFWAEVHYNSIYPEGDLPTSETKKKKRWWHFGNKH 342 >ref|XP_003573222.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Brachypodium distachyon] gi|944059103|gb|KQJ94693.1| hypothetical protein BRADI_3g12600 [Brachypodium distachyon] Length = 310 Score = 67.0 bits (162), Expect = 6e-10 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRW 97 VIFLSFWAEVHYNSIYPEGD PT TKKKKRW Sbjct: 272 VIFLSFWAEVHYNSIYPEGDLPTSETKKKKRW 303 >ref|XP_012064764.1| PREDICTED: uncharacterized protein LOC105628058 [Jatropha curcas] gi|802551377|ref|XP_012064765.1| PREDICTED: uncharacterized protein LOC105628058 [Jatropha curcas] gi|643738025|gb|KDP44013.1| hypothetical protein JCGZ_05480 [Jatropha curcas] Length = 351 Score = 67.0 bits (162), Expect = 8e-10 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDDY 139 VI LSFWAEVHYNSI+P+GD P TKKKK+W+ +++H++ D+Y Sbjct: 305 VILLSFWAEVHYNSIFPQGDWPVCETKKKKKWRMFRNKHLDSLDEY 350 >ref|XP_008800530.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X2 [Phoenix dactylifera] Length = 312 Score = 66.6 bits (161), Expect = 9e-10 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEH 118 VIFLSFWAEVHYNSIYPEGD PT TK+KKRW ++H Sbjct: 274 VIFLSFWAEVHYNSIYPEGDLPTSETKRKKRWWHFGNKH 312 >ref|XP_008800529.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X1 [Phoenix dactylifera] Length = 342 Score = 66.6 bits (161), Expect = 1e-09 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEH 118 VIFLSFWAEVHYNSIYPEGD PT TK+KKRW ++H Sbjct: 304 VIFLSFWAEVHYNSIYPEGDLPTSETKRKKRWWHFGNKH 342 >ref|XP_007143734.1| hypothetical protein PHAVU_007G097000g [Phaseolus vulgaris] gi|561016924|gb|ESW15728.1| hypothetical protein PHAVU_007G097000g [Phaseolus vulgaris] Length = 357 Score = 66.6 bits (161), Expect = 1e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRW 97 VIFLSFWAEVHYNSIYPEGD P+F+T+KKK+W Sbjct: 321 VIFLSFWAEVHYNSIYPEGDLPSFQTRKKKKW 352 >gb|AFK48767.1| unknown [Lotus japonicus] Length = 95 Score = 62.0 bits (149), Expect = 2e-09 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEH 118 VIFLSFWAEVHYNSIYP+GD P+ ++KKKRW + +H Sbjct: 57 VIFLSFWAEVHYNSIYPQGDIPSDESRKKKRWWNFRTKH 95 >ref|XP_004291568.1| PREDICTED: uncharacterized protein LOC101296346 isoform X1 [Fragaria vesca subsp. vesca] gi|764543134|ref|XP_011459288.1| PREDICTED: uncharacterized protein LOC101296346 isoform X1 [Fragaria vesca subsp. vesca] Length = 348 Score = 65.9 bits (159), Expect = 2e-09 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = +2 Query: 2 VIFLSFWAEVHYNSIYPEGDCPTFRTKKKKRWQAAQHEHVELPDDYN 142 VI LSFWAEVHYNSIY EGD PTF TKKKK+ ++++H+E+ + Y+ Sbjct: 302 VICLSFWAEVHYNSIYSEGDVPTFETKKKKKRGTSRNKHLEVSNIYH 348