BLASTX nr result
ID: Rehmannia27_contig00034820
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00034820 (431 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20141.1| hypothetical protein MIMGU_mgv1a024429mg [Erythra... 61 1e-08 ref|XP_012858491.1| PREDICTED: uncharacterized protein LOC105977... 61 1e-08 ref|XP_011076565.1| PREDICTED: cleavage and polyadenylation spec... 60 3e-08 ref|XP_008375391.1| PREDICTED: uncharacterized protein LOC103438... 57 3e-07 ref|XP_007218318.1| hypothetical protein PRUPE_ppa008392mg [Prun... 57 4e-07 ref|XP_008376957.1| PREDICTED: protein transport protein Sec24-l... 57 4e-07 ref|XP_009362765.1| PREDICTED: wiskott-Aldrich syndrome protein ... 57 4e-07 ref|XP_008347213.1| PREDICTED: uncharacterized protein LOC103410... 57 4e-07 ref|XP_008375255.1| PREDICTED: uncharacterized protein LOC103438... 57 4e-07 ref|XP_009363765.1| PREDICTED: wiskott-Aldrich syndrome protein-... 55 3e-06 ref|XP_006435975.1| hypothetical protein CICLE_v10033529mg [Citr... 55 4e-06 gb|KDO67597.1| hypothetical protein CISIN_1g020960mg [Citrus sin... 55 4e-06 ref|XP_015575766.1| PREDICTED: uncharacterized protein LOC107261... 54 7e-06 emb|CDP13872.1| unnamed protein product [Coffea canephora] 54 7e-06 ref|XP_008234153.1| PREDICTED: verprolin [Prunus mume] 54 7e-06 ref|XP_004307752.1| PREDICTED: formin-like protein 2 [Fragaria v... 54 7e-06 gb|EEF41610.1| conserved hypothetical protein [Ricinus communis] 54 8e-06 >gb|EYU20141.1| hypothetical protein MIMGU_mgv1a024429mg [Erythranthe guttata] Length = 267 Score = 61.2 bits (147), Expect = 1e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPPF 102 AAGA+IFGDDFMSGF+ GAARDASATISTYP F Sbjct: 233 AAGALIFGDDFMSGFDASGAARDASATISTYPRF 266 >ref|XP_012858491.1| PREDICTED: uncharacterized protein LOC105977690 [Erythranthe guttata] Length = 272 Score = 61.2 bits (147), Expect = 1e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPPF 102 AAGA+IFGDDFMSGF+ GAARDASATISTYP F Sbjct: 238 AAGALIFGDDFMSGFDASGAARDASATISTYPRF 271 >ref|XP_011076565.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 6 [Sesamum indicum] Length = 318 Score = 60.5 bits (145), Expect = 3e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPPF 102 AAGAVIFGDDF+SGF++PGA+ D S TISTYPPF Sbjct: 285 AAGAVIFGDDFLSGFDLPGASGDPSLTISTYPPF 318 >ref|XP_008375391.1| PREDICTED: uncharacterized protein LOC103438634 [Malus domestica] Length = 271 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPPF 102 AAGAVIFGDDFMSGF+VP +DAS TIST PPF Sbjct: 238 AAGAVIFGDDFMSGFDVPSGLQDASLTISTDPPF 271 >ref|XP_007218318.1| hypothetical protein PRUPE_ppa008392mg [Prunus persica] gi|462414780|gb|EMJ19517.1| hypothetical protein PRUPE_ppa008392mg [Prunus persica] Length = 333 Score = 57.4 bits (137), Expect = 4e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPPF 102 AAGAVIFGDDFMSGF+VP +DAS TIST PPF Sbjct: 300 AAGAVIFGDDFMSGFDVPSGLQDASLTISTDPPF 333 >ref|XP_008376957.1| PREDICTED: protein transport protein Sec24-like At4g32640, partial [Malus domestica] Length = 341 Score = 57.4 bits (137), Expect = 4e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPPF 102 AAGAVIFGDDFMSGF+VP +DAS TIST PPF Sbjct: 308 AAGAVIFGDDFMSGFDVPSGLQDASLTISTDPPF 341 >ref|XP_009362765.1| PREDICTED: wiskott-Aldrich syndrome protein family member 2-like [Pyrus x bretschneideri] Length = 349 Score = 57.4 bits (137), Expect = 4e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPPF 102 AAGAVIFGDDFMSGF+VP +DAS TIST PPF Sbjct: 316 AAGAVIFGDDFMSGFDVPSGLQDASLTISTDPPF 349 >ref|XP_008347213.1| PREDICTED: uncharacterized protein LOC103410258 [Malus domestica] Length = 349 Score = 57.4 bits (137), Expect = 4e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPPF 102 AAGAVIFGDDFMSGF+VP +DAS TIST PPF Sbjct: 316 AAGAVIFGDDFMSGFDVPSGLQDASLTISTDPPF 349 >ref|XP_008375255.1| PREDICTED: uncharacterized protein LOC103438493 [Malus domestica] gi|657969241|ref|XP_008376335.1| PREDICTED: uncharacterized protein LOC103439556 [Malus domestica] Length = 349 Score = 57.4 bits (137), Expect = 4e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPPF 102 AAGAVIFGDDFMSGF+VP +DAS TIST PPF Sbjct: 316 AAGAVIFGDDFMSGFDVPSGLQDASLTISTDPPF 349 >ref|XP_009363765.1| PREDICTED: wiskott-Aldrich syndrome protein-like [Pyrus x bretschneideri] Length = 341 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPPF 102 AAGAVIFGDDFMSGF+VP +DAS TIS PPF Sbjct: 308 AAGAVIFGDDFMSGFDVPSGLQDASLTISIDPPF 341 >ref|XP_006435975.1| hypothetical protein CICLE_v10033529mg [Citrus clementina] gi|985459907|ref|XP_015388158.1| PREDICTED: probable inactive serine/threonine-protein kinase slob2 isoform X1 [Citrus sinensis] gi|557538171|gb|ESR49215.1| hypothetical protein CICLE_v10033529mg [Citrus clementina] Length = 318 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPP 99 AAGAVIFGDDFMSGF+VP DAS TIST PP Sbjct: 285 AAGAVIFGDDFMSGFDVPAGLHDASLTISTDPP 317 >gb|KDO67597.1| hypothetical protein CISIN_1g020960mg [Citrus sinensis] Length = 319 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPP 99 AAGAVIFGDDFMSGF+VP DAS TIST PP Sbjct: 286 AAGAVIFGDDFMSGFDVPAGLHDASLTISTDPP 318 >ref|XP_015575766.1| PREDICTED: uncharacterized protein LOC107261396 [Ricinus communis] Length = 307 Score = 53.9 bits (128), Expect = 7e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPPF 102 AAGAVIFGDDFMSGF++P D S TIST PPF Sbjct: 274 AAGAVIFGDDFMSGFDIPATLPDPSLTISTDPPF 307 >emb|CDP13872.1| unnamed protein product [Coffea canephora] Length = 321 Score = 53.9 bits (128), Expect = 7e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPPF 102 AAGAVIFGDDFMSGF+ P +DAS TIST PPF Sbjct: 288 AAGAVIFGDDFMSGFDFPRNLQDASLTISTDPPF 321 >ref|XP_008234153.1| PREDICTED: verprolin [Prunus mume] Length = 327 Score = 53.9 bits (128), Expect = 7e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPPF 102 AAGAVIFGDDFMSGF++P +DAS TIS PPF Sbjct: 294 AAGAVIFGDDFMSGFDMPSGLQDASLTISIDPPF 327 >ref|XP_004307752.1| PREDICTED: formin-like protein 2 [Fragaria vesca subsp. vesca] Length = 338 Score = 53.9 bits (128), Expect = 7e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPPF 102 AAGAVIFGDDFMSGF+VP ++AS TIS PPF Sbjct: 305 AAGAVIFGDDFMSGFDVPSGLQNASVTISADPPF 338 >gb|EEF41610.1| conserved hypothetical protein [Ricinus communis] Length = 378 Score = 53.9 bits (128), Expect = 8e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +1 Query: 1 AAGAVIFGDDFMSGFNVPGAARDASATISTYPPF 102 AAGAVIFGDDFMSGF++P D S TIST PPF Sbjct: 345 AAGAVIFGDDFMSGFDIPATLPDPSLTISTDPPF 378