BLASTX nr result
ID: Rehmannia27_contig00034691
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00034691 (365 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090407.1| PREDICTED: glutaredoxin-C3-like isoform X2 [... 59 2e-08 >ref|XP_011090407.1| PREDICTED: glutaredoxin-C3-like isoform X2 [Sesamum indicum] Length = 194 Score = 59.3 bits (142), Expect = 2e-08 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = +1 Query: 262 MNGPSKALQLRQFSSSPLLFTRSNFSKGIHFVPR 363 MNG SKALQL QF SSPLLFTRSNFS GI FVPR Sbjct: 1 MNGSSKALQLHQFPSSPLLFTRSNFSDGIRFVPR 34