BLASTX nr result
ID: Rehmannia27_contig00034639
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00034639 (395 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070487.1| PREDICTED: inactive leucine-rich repeat rece... 58 3e-07 ref|XP_012839585.1| PREDICTED: inactive leucine-rich repeat rece... 57 5e-07 ref|XP_012846187.1| PREDICTED: inactive leucine-rich repeat rece... 57 5e-07 ref|XP_009616840.1| PREDICTED: inactive leucine-rich repeat rece... 54 8e-06 >ref|XP_011070487.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630 [Sesamum indicum] Length = 668 Score = 57.8 bits (138), Expect = 3e-07 Identities = 32/64 (50%), Positives = 38/64 (59%), Gaps = 3/64 (4%) Frame = +3 Query: 210 GTLLSRYNXXXXXXXXXXXXXX---TAFPQVKSGDAEALLALRASIDPLGVLQWGLGGIN 380 GTLLSRYN + FPQ +S D+ ALLAL+AS+DP G LQWG GG + Sbjct: 5 GTLLSRYNSSPSFLFFLLSSLFLLLSGFPQARSEDSVALLALKASVDPKGSLQWG-GGSD 63 Query: 381 VCQW 392 CQW Sbjct: 64 FCQW 67 >ref|XP_012839585.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630 [Erythranthe guttata] Length = 413 Score = 57.0 bits (136), Expect = 5e-07 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +3 Query: 276 TAFPQVKSGDAEALLALRASIDPLGVLQWGLGGINVCQWQ 395 T PQ KSGDAEALL+LRASIDPL LQW G +VC WQ Sbjct: 19 TTLPQAKSGDAEALLSLRASIDPLTKLQWSTGS-HVCTWQ 57 >ref|XP_012846187.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630 [Erythranthe guttata] gi|604318763|gb|EYU30255.1| hypothetical protein MIMGU_mgv1a002654mg [Erythranthe guttata] Length = 649 Score = 57.0 bits (136), Expect = 5e-07 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +3 Query: 276 TAFPQVKSGDAEALLALRASIDPLGVLQWGLGGINVCQWQ 395 T PQ KSGDAEALL+LRASIDPL LQW G +VC WQ Sbjct: 19 TTLPQAKSGDAEALLSLRASIDPLTKLQWSTGS-HVCTWQ 57 >ref|XP_009616840.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630 [Nicotiana tomentosiformis] Length = 678 Score = 53.5 bits (127), Expect = 8e-06 Identities = 28/60 (46%), Positives = 34/60 (56%) Frame = +3 Query: 216 LLSRYNXXXXXXXXXXXXXXTAFPQVKSGDAEALLALRASIDPLGVLQWGLGGINVCQWQ 395 L RYN FP VKSGDAEALLAL+A++DP +L W G ++CQWQ Sbjct: 15 LYLRYNSCHKMFFLIFSIFSIFFPLVKSGDAEALLALKATVDPKNILDW-KKGTDLCQWQ 73