BLASTX nr result
ID: Rehmannia27_contig00034577
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00034577 (823 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH99473.1| hypothetical protein Ccrd_022293 [Cynara carduncu... 56 5e-07 gb|AGW97687.1| RNA polymerase beta (chloroplast) [Ipomoea pedice... 60 1e-06 >gb|KVH99473.1| hypothetical protein Ccrd_022293 [Cynara cardunculus var. scolymus] Length = 71 Score = 55.8 bits (133), Expect = 5e-07 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +2 Query: 659 VLTTPLILSFMLLLPSDMSDPGHPNWIDWDDSFSFR 766 VL T LIL FML LP +MS GHP+W WDDSFSFR Sbjct: 27 VLNTSLILRFMLQLPRNMSGAGHPDWTKWDDSFSFR 62 >gb|AGW97687.1| RNA polymerase beta (chloroplast) [Ipomoea pedicellaris] Length = 718 Score = 60.1 bits (144), Expect = 1e-06 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = -1 Query: 118 FFSWCTYLSRMKGNFHVRF*GGEILYIGSYPNFSFARPI 2 FF WCTYLSRMKGN HVRF G I SYPNFSFARPI Sbjct: 152 FFIWCTYLSRMKGNIHVRFRRGG-APIESYPNFSFARPI 189