BLASTX nr result
ID: Rehmannia27_contig00033945
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00033945 (907 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012570593.1| PREDICTED: probable peroxygenase 4 [Cicer ar... 56 7e-06 >ref|XP_012570593.1| PREDICTED: probable peroxygenase 4 [Cicer arietinum] Length = 190 Score = 55.8 bits (133), Expect = 7e-06 Identities = 31/48 (64%), Positives = 34/48 (70%) Frame = -3 Query: 905 FREIGCGLLLSSVAAVFINLGLSGKTRPVNSLLYPMFLFFVLIIQVGN 762 FR IGCGL+LSSVAA+FINLGLS KTRP F F LII+V N Sbjct: 43 FRAIGCGLILSSVAAIFINLGLSQKTRP--------FPFIFLIIEVKN 82