BLASTX nr result
ID: Rehmannia27_contig00033694
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00033694 (1192 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076135.1| PREDICTED: uncharacterized protein LOC105160... 58 1e-05 >ref|XP_011076135.1| PREDICTED: uncharacterized protein LOC105160458 [Sesamum indicum] Length = 466 Score = 58.2 bits (139), Expect = 1e-05 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +2 Query: 1094 NNACKFFLQKRRWASCWSLYSCFGSYKHSKRIG 1192 N A +QKRRW SCWSLY CFGSYKHSKRIG Sbjct: 23 NRAQPSTVQKRRWGSCWSLYWCFGSYKHSKRIG 55