BLASTX nr result
ID: Rehmannia27_contig00033687
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00033687 (447 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074578.1| PREDICTED: uncharacterized protein LOC105159... 79 2e-15 >ref|XP_011074578.1| PREDICTED: uncharacterized protein LOC105159266 [Sesamum indicum] Length = 223 Score = 79.0 bits (193), Expect = 2e-15 Identities = 37/45 (82%), Positives = 38/45 (84%) Frame = -1 Query: 426 SGGNDFLLHAANGGLMQVLWIWKNLPKRDGEKYLSEDVSTPMNAE 292 SGGNDFLLHAANGGLMQVLW WKNLPK DGEK L ED ST NA+ Sbjct: 178 SGGNDFLLHAANGGLMQVLWNWKNLPKLDGEKSLLEDASTMSNAD 222