BLASTX nr result
ID: Rehmannia27_contig00033582
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00033582 (438 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076566.1| PREDICTED: uncharacterized protein LOC105160... 61 2e-08 ref|XP_009791713.1| PREDICTED: uncharacterized protein LOC104238... 55 4e-06 ref|XP_012858490.1| PREDICTED: uncharacterized protein LOC105977... 54 6e-06 gb|EYU20140.1| hypothetical protein MIMGU_mgv1a005683mg [Erythra... 54 6e-06 >ref|XP_011076566.1| PREDICTED: uncharacterized protein LOC105160781 [Sesamum indicum] Length = 498 Score = 61.2 bits (147), Expect = 2e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -2 Query: 437 LPQEEKADEFVSIVDKFLQRVFGVAEEPRLQAVT 336 LPQEEK +EFVSIVDKFLQRVFGVAEEP LQA T Sbjct: 465 LPQEEKPEEFVSIVDKFLQRVFGVAEEPLLQAAT 498 >ref|XP_009791713.1| PREDICTED: uncharacterized protein LOC104238907, partial [Nicotiana sylvestris] Length = 423 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 437 LPQEEKADEFVSIVDKFLQRVFGVAEEPRLQAVT 336 LP EEK D+FVSIVD+FL+RVFGV +EPRLQ T Sbjct: 390 LPHEEKVDKFVSIVDRFLERVFGVQKEPRLQPAT 423 >ref|XP_012858490.1| PREDICTED: uncharacterized protein LOC105977689 [Erythranthe guttata] Length = 473 Score = 54.3 bits (129), Expect = 6e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 437 LPQEEKADEFVSIVDKFLQRVFGVAEEPRLQAVT 336 LPQEEK +EFV IVDKFL++VFGVA+ PRLQ V+ Sbjct: 440 LPQEEKPEEFVDIVDKFLRQVFGVAQAPRLQVVS 473 >gb|EYU20140.1| hypothetical protein MIMGU_mgv1a005683mg [Erythranthe guttata] Length = 474 Score = 54.3 bits (129), Expect = 6e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 437 LPQEEKADEFVSIVDKFLQRVFGVAEEPRLQAVT 336 LPQEEK +EFV IVDKFL++VFGVA+ PRLQ V+ Sbjct: 441 LPQEEKPEEFVDIVDKFLRQVFGVAQAPRLQVVS 474