BLASTX nr result
ID: Rehmannia27_contig00033339
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00033339 (496 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072452.1| PREDICTED: protein CHUP1, chloroplastic [Ses... 59 2e-07 >ref|XP_011072452.1| PREDICTED: protein CHUP1, chloroplastic [Sesamum indicum] Length = 630 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 185 MAVKEKRDNPITPVLFKFGVVLAFSLGGIVYTFFRN 78 M VKEKR++PI+PVL K G LAFSLGGIVYTFFR+ Sbjct: 1 MGVKEKRESPISPVLLKLGAALAFSLGGIVYTFFRS 36