BLASTX nr result
ID: Rehmannia27_contig00033297
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00033297 (825 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012831203.1| PREDICTED: kinectin-like [Erythranthe guttata] 105 5e-22 ref|XP_011080049.1| PREDICTED: myosin heavy chain, non-muscle-li... 86 3e-15 >ref|XP_012831203.1| PREDICTED: kinectin-like [Erythranthe guttata] Length = 1000 Score = 105 bits (262), Expect = 5e-22 Identities = 68/141 (48%), Positives = 81/141 (57%), Gaps = 7/141 (4%) Frame = +3 Query: 3 AQDKAIASEIADLHLAIEHIIKYGLESEYSPDGLTARIKQLERNRASLRNGTPLSTD--- 173 AQDKAI SEIADL LAI HIIKYGLESEYSP LT+R KQLE +A L+ TP S+ Sbjct: 853 AQDKAITSEIADLRLAIAHIIKYGLESEYSPYRLTSRTKQLETEQARLKKRTPASSSSGY 912 Query: 174 VRKQEKSRRFTQPEDSNKRMKQEKQHEPLLQHEQEIKSPPRLNKLVNEAAMPHPSKRRRT 353 R +EK +RF Q D KR QE+QH+ + E + V A +KR+RT Sbjct: 913 ARNREKGKRFNQSHDEKKRKLQEQQHD---EPNTEARFCRSQTNEVPTALHGKANKRQRT 969 Query: 354 NISWH----EVEGVRHLRSPP 404 N + EGVRH PP Sbjct: 970 NNLPYRGPLHQEGVRHHARPP 990 >ref|XP_011080049.1| PREDICTED: myosin heavy chain, non-muscle-like [Sesamum indicum] Length = 1010 Score = 85.5 bits (210), Expect = 3e-15 Identities = 59/144 (40%), Positives = 81/144 (56%), Gaps = 1/144 (0%) Frame = +3 Query: 3 AQDKAIASEIADLHLAIEHIIKYGLESEYSPDGLTARIKQLERNRASLRN-GTPLSTDVR 179 AQD+AI SEI DL AIEHIIKYGLE EYS D LT RI QLE++R ++N S++ R Sbjct: 838 AQDEAIDSEIKDLRYAIEHIIKYGLEYEYSVDTLTLRINQLEKDREGMKNRRLSSSSNPR 897 Query: 180 KQEKSRRFTQPEDSNKRMKQEKQHEPLLQHEQEIKSPPRLNKLVNEAAMPHPSKRRRTNI 359 KQE ++R P +NK Q++QHE +E+ P+ A +P + +++ Sbjct: 898 KQESNKR---PAHANKSKAQQRQHEA----TREVHRVPK-------AQVPEQGSEKGSHL 943 Query: 360 SWHEVEGVRHLRSPPECHRLRH*T 431 +W RH +S R RH T Sbjct: 944 AWKS----RHWQSKT---RKRHAT 960