BLASTX nr result
ID: Rehmannia27_contig00033073
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00033073 (519 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27789.1| hypothetical protein MIMGU_mgv1a003034mg [Erythra... 84 5e-16 ref|XP_012849341.1| PREDICTED: pentatricopeptide repeat-containi... 84 5e-16 ref|XP_011096064.1| PREDICTED: pentatricopeptide repeat-containi... 84 7e-16 ref|XP_009588483.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-14 ref|XP_009757171.1| PREDICTED: pentatricopeptide repeat-containi... 78 1e-13 gb|KGN64520.1| hypothetical protein Csa_1G062950 [Cucumis sativus] 72 2e-12 ref|XP_015883860.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-11 emb|CDP04402.1| unnamed protein product [Coffea canephora] 69 1e-10 ref|XP_008441068.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 69 2e-10 gb|ADN34051.1| pentatricopeptide repeat-containing protein [Cucu... 69 2e-10 ref|XP_006467434.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-09 ref|XP_006449728.1| hypothetical protein CICLE_v10014539mg [Citr... 66 1e-09 ref|XP_011047990.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-09 ref|XP_015960371.1| PREDICTED: pentatricopeptide repeat-containi... 65 4e-09 ref|XP_015960370.1| PREDICTED: pentatricopeptide repeat-containi... 65 4e-09 ref|XP_010276099.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-09 ref|XP_007026082.1| Pentatricopeptide repeat superfamily protein... 63 1e-08 ref|XP_012091342.1| PREDICTED: pentatricopeptide repeat-containi... 62 3e-08 ref|XP_012449936.1| PREDICTED: pentatricopeptide repeat-containi... 62 3e-08 gb|KDP20745.1| hypothetical protein JCGZ_21216 [Jatropha curcas] 62 3e-08 >gb|EYU27789.1| hypothetical protein MIMGU_mgv1a003034mg [Erythranthe guttata] Length = 613 Score = 84.3 bits (207), Expect = 5e-16 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITN 516 K RN+FVR HFGKK T+P +EDI+FKAVCVNIRQKKW FLD+LSSS+T+ Sbjct: 9 KRRNLFVRGLHFGKKFTTPTAEDIVFKAVCVNIRQKKWNFLDQLSSSLTD 58 >ref|XP_012849341.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Erythranthe guttata] Length = 655 Score = 84.3 bits (207), Expect = 5e-16 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITN 516 K RN+FVR HFGKK T+P +EDI+FKAVCVNIRQKKW FLD+LSSS+T+ Sbjct: 9 KRRNLFVRGLHFGKKFTTPTAEDIVFKAVCVNIRQKKWNFLDQLSSSLTD 58 >ref|XP_011096064.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Sesamum indicum] Length = 655 Score = 84.0 bits (206), Expect = 7e-16 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 K+RN+FVR HF K+ T P +EDIIF AVCVNIRQKKWKFLD+LSSS+TNS Sbjct: 9 KSRNLFVRGLHFAKQSTRPSAEDIIFSAVCVNIRQKKWKFLDQLSSSLTNS 59 >ref|XP_009588483.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Nicotiana tomentosiformis] Length = 655 Score = 79.7 bits (195), Expect = 2e-14 Identities = 32/51 (62%), Positives = 46/51 (90%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 + RN+FVR+ H G++ T+P +EDI+FKAVC+N+R+KKWKFLD++SSS+TNS Sbjct: 9 QRRNLFVRTLHLGQQFTTPNTEDILFKAVCMNLREKKWKFLDQISSSLTNS 59 >ref|XP_009757171.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Nicotiana sylvestris] Length = 655 Score = 77.8 bits (190), Expect = 1e-13 Identities = 31/51 (60%), Positives = 46/51 (90%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 + RN+FVR+ H G++ T+P +EDI+FKAVCVN+R+KKWKFLD+++S++TNS Sbjct: 9 QRRNLFVRTLHLGQQFTTPKTEDILFKAVCVNLREKKWKFLDQMTSTLTNS 59 >gb|KGN64520.1| hypothetical protein Csa_1G062950 [Cucumis sativus] Length = 198 Score = 71.6 bits (174), Expect = 2e-12 Identities = 30/51 (58%), Positives = 42/51 (82%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 + ++F R FH GKKL SP +EDII KA+CVN++Q++WKFL++LS S+TNS Sbjct: 75 RGSSVFRRGFHTGKKLLSPSTEDIICKAICVNLKQRRWKFLEQLSPSLTNS 125 >ref|XP_015883860.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Ziziphus jujuba] Length = 652 Score = 72.0 bits (175), Expect = 1e-11 Identities = 27/51 (52%), Positives = 42/51 (82%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 K + R FH GKK ++P +EDI+F+A+C+N++Q+KWKFL+++SSS+TNS Sbjct: 9 KRSYLLTRGFHVGKKFSNPSAEDIVFRAICINLKQRKWKFLEQISSSLTNS 59 >emb|CDP04402.1| unnamed protein product [Coffea canephora] Length = 655 Score = 68.9 bits (167), Expect = 1e-10 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 K + +F+R FH K+ +P +EDIIFKA+CVN+RQKKW LDK+ S+T+S Sbjct: 9 KRQCLFIRGFHLAKQFANPSAEDIIFKAICVNLRQKKWNLLDKMLPSLTSS 59 >ref|XP_008441068.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Cucumis melo] Length = 653 Score = 68.6 bits (166), Expect = 2e-10 Identities = 28/47 (59%), Positives = 40/47 (85%) Frame = +1 Query: 379 IFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 +F R F GKKL SP +EDII+KA+CVN++Q++WKFL+++S S+TNS Sbjct: 13 VFRRGFRTGKKLLSPSTEDIIYKAICVNLKQRRWKFLEQVSPSLTNS 59 >gb|ADN34051.1| pentatricopeptide repeat-containing protein [Cucumis melo subsp. melo] Length = 653 Score = 68.6 bits (166), Expect = 2e-10 Identities = 28/47 (59%), Positives = 40/47 (85%) Frame = +1 Query: 379 IFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 +F R F GKKL SP +EDII+KA+CVN++Q++WKFL+++S S+TNS Sbjct: 13 VFRRGFRTGKKLLSPSTEDIIYKAICVNLKQRRWKFLEQVSPSLTNS 59 >ref|XP_006467434.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Citrus sinensis] gi|568826147|ref|XP_006467435.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Citrus sinensis] gi|641859540|gb|KDO78230.1| hypothetical protein CISIN_1g006154mg [Citrus sinensis] Length = 658 Score = 65.9 bits (159), Expect = 1e-09 Identities = 25/51 (49%), Positives = 41/51 (80%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 K+ + R+FH GK+ +P +EDI+F+A+CVN+RQ+KWK L++++ S+TNS Sbjct: 11 KSNSPLSRAFHVGKQFANPSTEDIVFRAICVNLRQRKWKILEQMAPSLTNS 61 >ref|XP_006449728.1| hypothetical protein CICLE_v10014539mg [Citrus clementina] gi|557552339|gb|ESR62968.1| hypothetical protein CICLE_v10014539mg [Citrus clementina] Length = 658 Score = 65.9 bits (159), Expect = 1e-09 Identities = 25/51 (49%), Positives = 41/51 (80%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 K+ + R+FH GK+ +P +EDI+F+A+CVN+RQ+KWK L++++ S+TNS Sbjct: 11 KSNSPLSRAFHVGKQFANPSTEDIVFRAICVNLRQRKWKILEQMAPSLTNS 61 >ref|XP_011047990.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Populus euphratica] Length = 654 Score = 65.1 bits (157), Expect = 3e-09 Identities = 25/51 (49%), Positives = 39/51 (76%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 K R+ RSFH GK + P SED++F+A+CVN++Q++W FL+K +S+TN+ Sbjct: 9 KRRSFLERSFHLGKSILKPISEDVVFRAICVNLKQRRWNFLEKNLASLTNA 59 >ref|XP_015960371.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial-like isoform X2 [Arachis duranensis] Length = 785 Score = 64.7 bits (156), Expect = 4e-09 Identities = 25/51 (49%), Positives = 39/51 (76%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 K+RN+ R+FH GK+ +P S DI+FKA+CVN++ K+W L++LS +T+S Sbjct: 145 KSRNLLARAFHAGKRFLNPDSGDIVFKAICVNLKHKRWSVLERLSPKLTSS 195 >ref|XP_015960370.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial-like isoform X1 [Arachis duranensis] Length = 803 Score = 64.7 bits (156), Expect = 4e-09 Identities = 25/51 (49%), Positives = 39/51 (76%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 K+RN+ R+FH GK+ +P S DI+FKA+CVN++ K+W L++LS +T+S Sbjct: 163 KSRNLLARAFHAGKRFLNPDSGDIVFKAICVNLKHKRWSVLERLSPKLTSS 213 >ref|XP_010276099.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial isoform X1 [Nelumbo nucifera] gi|720064894|ref|XP_010276100.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial isoform X1 [Nelumbo nucifera] gi|720064897|ref|XP_010276101.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial isoform X1 [Nelumbo nucifera] gi|720064900|ref|XP_010276102.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial isoform X1 [Nelumbo nucifera] gi|720064903|ref|XP_010276103.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial isoform X1 [Nelumbo nucifera] Length = 658 Score = 63.9 bits (154), Expect = 6e-09 Identities = 24/44 (54%), Positives = 39/44 (88%) Frame = +1 Query: 388 RSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 R+FH GK+ ++PG EDIIF A+CV++R+++W FL+K++S++TNS Sbjct: 17 RNFHAGKRFSNPGGEDIIFNAICVHLRRQRWGFLEKITSNLTNS 60 >ref|XP_007026082.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508781448|gb|EOY28704.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 722 Score = 63.2 bits (152), Expect = 1e-08 Identities = 23/51 (45%), Positives = 40/51 (78%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 + ++F R H GK+ + P SEDI+F+A+CVN+R ++WKFL+++S S+T++ Sbjct: 75 RRTSLFSRGLHVGKQFSCPSSEDIVFRAICVNLRHRRWKFLEQVSPSLTDA 125 >ref|XP_012091342.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial [Jatropha curcas] Length = 653 Score = 62.0 bits (149), Expect = 3e-08 Identities = 23/51 (45%), Positives = 39/51 (76%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 K + R FH GK ++P +EDI+FKA+CVN+++K+W FL+++S ++T+S Sbjct: 9 KRSPVLNRGFHVGKHFSNPSAEDIVFKAICVNLKRKRWNFLEQMSPTLTSS 59 >ref|XP_012449936.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11710, mitochondrial isoform X1 [Gossypium raimondii] gi|763800242|gb|KJB67197.1| hypothetical protein B456_010G180200 [Gossypium raimondii] Length = 663 Score = 62.0 bits (149), Expect = 3e-08 Identities = 24/51 (47%), Positives = 37/51 (72%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 K F R H GK+ + P SEDI+F+A+CVN++ ++WKFLD++ S+TN+ Sbjct: 17 KRSCFFNRGLHLGKQFSCPNSEDIVFRAICVNLKHRRWKFLDQVFPSLTNA 67 >gb|KDP20745.1| hypothetical protein JCGZ_21216 [Jatropha curcas] Length = 675 Score = 62.0 bits (149), Expect = 3e-08 Identities = 23/51 (45%), Positives = 39/51 (76%) Frame = +1 Query: 367 KNRNIFVRSFHFGKKLTSPGSEDIIFKAVCVNIRQKKWKFLDKLSSSITNS 519 K + R FH GK ++P +EDI+FKA+CVN+++K+W FL+++S ++T+S Sbjct: 31 KRSPVLNRGFHVGKHFSNPSAEDIVFKAICVNLKRKRWNFLEQMSPTLTSS 81