BLASTX nr result
ID: Rehmannia27_contig00032851
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00032851 (421 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26969.1| hypothetical protein MIMGU_mgv1a014989mg [Erythra... 57 2e-07 >gb|EYU26969.1| hypothetical protein MIMGU_mgv1a014989mg [Erythranthe guttata] Length = 171 Score = 57.0 bits (136), Expect = 2e-07 Identities = 32/66 (48%), Positives = 39/66 (59%) Frame = +2 Query: 224 MLTISSISSNVFKKGIPLYASTSINPFPFSKFSKKQLNMAQYGTQDRAFNSSRVVGQAHD 403 M TIS ISSN FKK IP P S+ S K+L +YG Q F+S RV +AHD Sbjct: 1 MSTISLISSNFFKKTIPHNTH-----LPLSRLSMKRLIKPKYGAQTYPFSSLRVATRAHD 55 Query: 404 PSYIPG 421 P+Y+PG Sbjct: 56 PTYVPG 61