BLASTX nr result
ID: Rehmannia27_contig00032849
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00032849 (374 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011084354.1| PREDICTED: aminodeoxychorismate synthase, ch... 73 9e-13 >ref|XP_011084354.1| PREDICTED: aminodeoxychorismate synthase, chloroplastic isoform X1 [Sesamum indicum] gi|747074704|ref|XP_011084355.1| PREDICTED: aminodeoxychorismate synthase, chloroplastic isoform X1 [Sesamum indicum] gi|747074706|ref|XP_011084356.1| PREDICTED: aminodeoxychorismate synthase, chloroplastic isoform X1 [Sesamum indicum] gi|747074708|ref|XP_011084357.1| PREDICTED: aminodeoxychorismate synthase, chloroplastic isoform X1 [Sesamum indicum] Length = 924 Score = 73.2 bits (178), Expect = 9e-13 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = +2 Query: 236 MGFALCSSSTEISFSCLETISQNKYLKSVIPKGFSRLGDLNWKDKH 373 MGF++CSSS E+SFSCLETIS K LKSV+P+GF+RLGDLN KD++ Sbjct: 1 MGFSVCSSSAEVSFSCLETISLGKNLKSVVPRGFTRLGDLNKKDRN 46