BLASTX nr result
ID: Rehmannia27_contig00032760
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00032760 (367 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089397.1| PREDICTED: calcium-transporting ATPase 4, en... 54 6e-06 >ref|XP_011089397.1| PREDICTED: calcium-transporting ATPase 4, endoplasmic reticulum-type-like [Sesamum indicum] Length = 1070 Score = 53.5 bits (127), Expect = 6e-06 Identities = 25/32 (78%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = +3 Query: 270 MGKGGQNYGRSENL-DSDKEPKGDCFAAWSKD 362 MGKGGQNYGRSE+L + KEPKGD +AAWSKD Sbjct: 1 MGKGGQNYGRSEDLGGAGKEPKGDYYAAWSKD 32