BLASTX nr result
ID: Rehmannia27_contig00032710
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00032710 (421 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101381.1| PREDICTED: protein MITOFERRINLIKE 1, chlorop... 60 4e-08 >ref|XP_011101381.1| PREDICTED: protein MITOFERRINLIKE 1, chloroplastic [Sesamum indicum] Length = 416 Score = 60.5 bits (145), Expect = 4e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 2 GYFAFETARLTILNQYLKRKELEVVVLSSAASLDQSG 112 GYFAFETARLT+L+QYLKRKELE V SAASL+QSG Sbjct: 380 GYFAFETARLTLLDQYLKRKELENVAFPSAASLNQSG 416