BLASTX nr result
ID: Rehmannia27_contig00032668
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00032668 (757 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010102818.1| hypothetical protein L484_004672 [Morus nota... 54 6e-06 >ref|XP_010102818.1| hypothetical protein L484_004672 [Morus notabilis] gi|587906044|gb|EXB94146.1| hypothetical protein L484_004672 [Morus notabilis] Length = 135 Score = 54.3 bits (129), Expect = 6e-06 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = -3 Query: 752 NTIRLNTNPLFSCRFRVVLSCRVRNCHPYPK 660 N +N NPLFSCRFRVVLSCR NCHPY + Sbjct: 38 NLFMINPNPLFSCRFRVVLSCRYSNCHPYSR 68