BLASTX nr result
ID: Rehmannia27_contig00032551
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00032551 (609 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083706.1| PREDICTED: myb-like protein X isoform X1 [Se... 63 1e-09 ref|XP_011083707.1| PREDICTED: transcriptional regulator ATRX is... 63 1e-09 >ref|XP_011083706.1| PREDICTED: myb-like protein X isoform X1 [Sesamum indicum] Length = 761 Score = 62.8 bits (151), Expect(2) = 1e-09 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = -1 Query: 528 NVVVETSSRPSLLEVLK*PSV*SQVFNQDTTIDLTKSIFWFRVPKKPTKI 379 + ET SR SLLE+LK S S++ NQ+TT+DLTKSIF FR PKKPTKI Sbjct: 708 DAAAETVSRTSLLEILKRSSAQSRLCNQETTVDLTKSIFAFRAPKKPTKI 757 Score = 26.9 bits (58), Expect(2) = 1e-09 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = -2 Query: 605 SQETRPTKNLTPKCSISQTKFTSQ 534 S+E RPT+ +T K S +QTK ++Q Sbjct: 682 SKEIRPTRAVTAKYSNTQTKMSNQ 705 >ref|XP_011083707.1| PREDICTED: transcriptional regulator ATRX isoform X2 [Sesamum indicum] Length = 754 Score = 62.8 bits (151), Expect(2) = 1e-09 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = -1 Query: 528 NVVVETSSRPSLLEVLK*PSV*SQVFNQDTTIDLTKSIFWFRVPKKPTKI 379 + ET SR SLLE+LK S S++ NQ+TT+DLTKSIF FR PKKPTKI Sbjct: 701 DAAAETVSRTSLLEILKRSSAQSRLCNQETTVDLTKSIFAFRAPKKPTKI 750 Score = 26.9 bits (58), Expect(2) = 1e-09 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = -2 Query: 605 SQETRPTKNLTPKCSISQTKFTSQ 534 S+E RPT+ +T K S +QTK ++Q Sbjct: 675 SKEIRPTRAVTAKYSNTQTKMSNQ 698