BLASTX nr result
ID: Rehmannia27_contig00032324
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00032324 (422 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008964091.1| hypothetical chloroplast RF1 [Ajuga reptans]... 55 2e-06 >ref|YP_008964091.1| hypothetical chloroplast RF1 [Ajuga reptans] gi|558697198|gb|AHA84953.1| hypothetical chloroplast RF1 [Ajuga reptans] Length = 1801 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 401 AENRDKNRFDLLVPENILSFRCRRIFRILNVDNYKD 294 AENRDKN FDLLVPENILSFRCRR RIL N K+ Sbjct: 1683 AENRDKNDFDLLVPENILSFRCRRKLRILICFNSKN 1718