BLASTX nr result
ID: Rehmannia27_contig00032299
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00032299 (358 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09735.1| hypothetical protein B456_001G161100 [Gossypium r... 59 3e-08 emb|CBI31107.3| unnamed protein product [Vitis vinifera] 54 2e-06 >gb|KJB09735.1| hypothetical protein B456_001G161100 [Gossypium raimondii] Length = 250 Score = 59.3 bits (142), Expect = 3e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +2 Query: 215 MAFSEPLVAYVVVGIPTCSSLPPYLRIQRWPLDVVVTL 328 +AFS+PLVAYVVVGIPTCSS PPYLRIQR PLD + L Sbjct: 21 LAFSQPLVAYVVVGIPTCSS-PPYLRIQRSPLDAWLIL 57 >emb|CBI31107.3| unnamed protein product [Vitis vinifera] Length = 217 Score = 53.9 bits (128), Expect = 2e-06 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -1 Query: 94 STIHRCKRLSWICEVGYSKAWSEGVLASIIS 2 STIHRCKRLS ICEVGYSKA E VLASIIS Sbjct: 4 STIHRCKRLSGICEVGYSKARPESVLASIIS 34