BLASTX nr result
ID: Rehmannia27_contig00032291
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00032291 (706 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF51216.1| conserved hypothetical protein [Ricinus communis] 77 7e-13 >gb|EEF51216.1| conserved hypothetical protein [Ricinus communis] Length = 358 Score = 76.6 bits (187), Expect = 7e-13 Identities = 38/108 (35%), Positives = 64/108 (59%) Frame = -2 Query: 669 IYHLYDETLLTYLGKYGVLRTYQTKDNPPITSNFVPKECRKIIRDMIRFVIFLHTQKKSL 490 I HL ET+ + +Y + Q P T+N+VP E RK+I+ M+ FV+ +H S Sbjct: 81 INHLKRETI-NPIARYPIPHR-QGPTIPSHTANYVPNEYRKLIKSMVTFVVDIHDAGYST 138 Query: 489 GGLSLDNLVVKGDLLKFWKIKFVKANDDTKRNDFSLLASILRELYEGQ 346 G + N+V+K +++KFWK++F+ A+ +K NDF L ++ L+ G+ Sbjct: 139 AGFGMPNIVIKNEVVKFWKVQFITASMGSKNNDFICLHRVVESLFSGE 186