BLASTX nr result
ID: Rehmannia27_contig00032157
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00032157 (354 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012854332.1| PREDICTED: F-box/LRR-repeat protein 3 [Eryth... 59 5e-08 ref|XP_011101041.1| PREDICTED: uncharacterized protein LOC105179... 58 1e-07 >ref|XP_012854332.1| PREDICTED: F-box/LRR-repeat protein 3 [Erythranthe guttata] Length = 587 Score = 59.3 bits (142), Expect = 5e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +2 Query: 2 RTLQCKQKQGKLSMSPLRPDEIFLDQRLKYSREDLLALQ 118 ++LQ K K GKLS+SPL+ D+IFLDQRLKYS+E+LLALQ Sbjct: 533 KSLQFKHKVGKLSVSPLKSDDIFLDQRLKYSKEELLALQ 571 >ref|XP_011101041.1| PREDICTED: uncharacterized protein LOC105179139 [Sesamum indicum] Length = 588 Score = 58.2 bits (139), Expect = 1e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +2 Query: 11 QCKQKQGKLSMSPLRPDEIFLDQRLKYSREDLLALQ 118 Q K++QGK S SPLR DEIFLDQRLKYSRE+LLALQ Sbjct: 536 QHKRRQGKPSTSPLRSDEIFLDQRLKYSREELLALQ 571