BLASTX nr result
ID: Rehmannia27_contig00032126
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00032126 (853 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012843655.1| PREDICTED: serine/arginine-rich splicing fac... 80 5e-14 emb|CDP08889.1| unnamed protein product [Coffea canephora] 57 3e-07 ref|XP_009598444.1| PREDICTED: serine/arginine-rich splicing fac... 61 3e-07 >ref|XP_012843655.1| PREDICTED: serine/arginine-rich splicing factor RS40-like isoform X1 [Erythranthe guttata] Length = 259 Score = 79.7 bits (195), Expect = 5e-14 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = -3 Query: 125 MVLPSYTFLRPLPFAFLMTLPSLQFPTCFNIDIMFIPDPVA 3 MV PSYTFLR LPFAFLMTL SLQFPTCFNIDIMFIPDPVA Sbjct: 1 MVPPSYTFLRSLPFAFLMTLHSLQFPTCFNIDIMFIPDPVA 41 >emb|CDP08889.1| unnamed protein product [Coffea canephora] Length = 70 Score = 56.6 bits (135), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 244 AGLLGYSMIFLNGWFSAFIFWLVPKIHVLVF 152 +GLLG SMIFL+GWFSA +FWLVPKIHV VF Sbjct: 35 SGLLGLSMIFLDGWFSASLFWLVPKIHVNVF 65 >ref|XP_009598444.1| PREDICTED: serine/arginine-rich splicing factor RS41-like isoform X1 [Nicotiana tomentosiformis] Length = 283 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -3 Query: 125 MVLPSYTFLRPLPFAFLMTLPSLQFPTCFNIDIMFIPDPVA 3 MVL SY+ LRPLPFAFLMTL S + TCFNID M I DPVA Sbjct: 1 MVLQSYSLLRPLPFAFLMTLLSPHYLTCFNIDSMIISDPVA 41