BLASTX nr result
ID: Rehmannia27_contig00031516
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00031516 (506 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094134.1| PREDICTED: probable inactive leucine-rich re... 59 3e-07 >ref|XP_011094134.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Sesamum indicum] gi|747092714|ref|XP_011094135.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Sesamum indicum] gi|747092716|ref|XP_011094136.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Sesamum indicum] Length = 786 Score = 58.9 bits (141), Expect = 3e-07 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = -3 Query: 150 MAKHVCHIVSLCLFVMFLSVSIAEHLESSQVQTLVKIKHLLNFPPVLKTW 1 MAKH C IV L LFV+ +SVS E +SSQV+TL++IK LLN P L +W Sbjct: 1 MAKHFCQIVFLFLFVLLISVSCREQQQSSQVETLLRIKLLLNSPSFLSSW 50